OGT Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

OGT Protein, Human (His) is the recombinant human-derived OGT protein, expressed by E. coli, with N-6*His & N-SUMO tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

OGT Protein, Human (His) is the recombinant human-derived OGT protein, expressed by E. coli, with N-6*His & N-SUMO tag.

Background

OGT is an enzyme that catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to serine or threonine residues in cytoplasmic and nuclear proteins, modifying them with a beta-linked N-acetylglucosamine (O-GlcNAc). It glycosylates a wide range of proteins, including histone H2B, AKT1, AMPK, ATG4B, CAPRIN1, EZH2, and others, regulating their cellular functions through crosstalk between glycosylation and phosphorylation or by affecting proteolytic processing. In muscle and adipocyte cells, OGT contributes to insulin resistance by glycosylating insulin signaling components and inhibiting AKT1 phosphorylation at 'Thr-308' (by similarity). Additionally, OGT regulates glycolysis by mediating the glycosylation of 6-phosphofructokinase PFKL, thereby inhibiting its activity. In chromatin structure, OGT plays a crucial role by mediating O-GlcNAcylation of histone H2B at 'Ser-112' and is recruited to CpG-rich transcription start sites of active genes via interaction with TET proteins (TET1, TET2, or TET3). The mitochondrial isoform (mOGT) exhibits cytotoxicity and induces apoptosis in various cell types, including the insulinoma cell line INS1.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    OGT; MGC22921; O-Linked N-Acetylglucosamine (GlcNAc) Transferase; FLJ23071; UDP-N-Acetylglucosamine--Peptide N-Acetylglucosaminyltransferase 110 KDa Subunit; CDNA FLJ61388, Highly Similar To UDP-N-Acetylglucosamine--PeptideN-Acetylglucosaminyltransferase

  • AA Sequence

    MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ

  • Molecular Weight

    Approximately 68 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00