OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc)
OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. Operating as a homotrimer, its engagement enhances immune response by activating and expanding T-cells. The interaction with TNFRSF4 contributes to intricate regulation, crucial for modulating T-cell functions and achieving effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. Operating as a homotrimer, its engagement enhances immune response by activating and expanding T-cells. The interaction with TNFRSF4 contributes to intricate regulation, crucial for modulating T-cell functions and achieving effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with C-mFc labeled tag.
Background
The OX40 Ligand/TNFSF4 Protein, a cytokine, specifically binds to TNFRSF4 and functions as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its engagement with TNFRSF4 serves to enhance the immune response by promoting the activation and expansion of T-cells. The interaction between OX40 Ligand and its receptor TNFRSF4 contributes to the intricate regulation of T-cell-mediated immune responses, playing a crucial role in modulating T-cell functions for an effective and controlled immune activation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P23510-1 (Q51-L183)
-
Gene ID7292
-
Molecular Construction
-
N-term
-
OX40L (Q51-L183)
Accession # P23510 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFSF4; Tumor Necrosis Factor (Ligand) Superfamily Member 4; Prev. TXGP1; Tumor Necrosis Factor Superfamily Member 4; Tumor Necrosis Factor Ligand Superfamily Member 4; Tumor Necrosis Factor Ligand 2B; OX-40L; OX40 Antigen Ligand; CD252; CD252 Antigen; Gp
-
AA Sequence
QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
-
Predicted Molecular Mass
42.3 kDa
-
Molecular Weight
Approximately 53-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
