1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands
  5. OX40 Ligand
  6. OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc)

OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc)

Cat. No.: HY-P704291
Handling Instructions Technical Support

OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. Operating as a homotrimer, its engagement enhances immune response by activating and expanding T-cells. The interaction with TNFRSF4 contributes to intricate regulation, crucial for modulating T-cell functions and achieving effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. Operating as a homotrimer, its engagement enhances immune response by activating and expanding T-cells. The interaction with TNFRSF4 contributes to intricate regulation, crucial for modulating T-cell functions and achieving effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc) is the recombinant human-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with C-mFc labeled tag.

Background

The OX40 Ligand/TNFSF4 Protein, a cytokine, specifically binds to TNFRSF4 and functions as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its engagement with TNFRSF4 serves to enhance the immune response by promoting the activation and expansion of T-cells. The interaction between OX40 Ligand and its receptor TNFRSF4 contributes to the intricate regulation of T-cell-mediated immune responses, playing a crucial role in modulating T-cell functions for an effective and controlled immune activation.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P23510-1 (Q51-L183)

Gene ID

7292

Molecular Construction
N-term
OX40L (Q51-L183)
Accession # P23510
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
OX40L; OX-40L; OX4OL; CD252; TNFSF4; OX40 Ligand; CD134 ligand; CD134L;  TXGP1; Glycoprotein Gp34
AA Sequence

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Predicted Molecular Mass
42.3 kDa
Molecular Weight

Approximately 53-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OX40 Ligand/TNFSF4 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P704291
Quantity:
MCE Japan Authorized Agent: