1. Recombinant Proteins
  2. Others
  3. PAEP Protein, Human (HEK293, Myc, His)

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, Myc, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, Myc, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with C-Myc, N-10*His labeled tag.

Background

The PAEP Protein, a glycoprotein, intricately regulates crucial steps during fertilization while also exerting immunomodulatory effects. In reproductive tissues, four distinct glycoforms—namely glycodelin-S, -A, -F, and -C—have been identified, each characterized by unique glycosylation patterns and biological activities. Glycodelin-A, for instance, exhibits both contraceptive and immunosuppressive activities. On the other hand, Glycodelin-C plays a role in stimulating the binding of spermatozoa to the zona pellucida. In contrast, Glycodelin-F serves to inhibit spermatozoa-zona pellucida binding and significantly suppresses the progesterone-induced acrosome reaction of spermatozoa. Additionally, Glycodelin-S, present in seminal plasma, maintains the uncapacitated state of human spermatozoa. The protein forms a homodimer, further emphasizing its structural complexity and functional diversity in orchestrating key events during fertilization and modulating immune responses.

Species

Human

Source

HEK293

Tag

C-Myc;N-10*His

Accession

P09466-1 (M19-F180)

Gene ID
Molecular Construction
N-term
10*His
PAEP (M19-F180)
Accession # P09466-1
Myc
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Alpha uterine protein; gD; GdA; GdF; GdS; Glycodelin A; Glycodelin; Glycodelin F; Glycodelin S; MGC138509; MGC142288; PAEG
AA Sequence

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Predicted Molecular Mass
23.9 kDa
Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PAEP Protein, Human (HEK293, Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PAEP Protein, Human (HEK293, Myc, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAEP Protein, Human (HEK293, Myc, His)
Cat. No.:
HY-P71669
Quantity:
MCE Japan Authorized Agent: