PAX8 Protein, Human (His)
Based on 1 Customer Validation
PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag.
The PAX8 protein operates as a transcription factor essential for the thyroid-specific expression of genes exclusive to thyroid cells, thereby preserving the functional differentiation of these cells. PAX8 plays a pivotal role in regulating the thyroid-specific gene expression profile, contributing to the specialized function of thyroid cells. Additionally, PAX8 interacts with WWTR1, suggesting a potential partnership in modulating gene expression and cellular processes within the thyroid cell type.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q06710 (P2-S146)
-
Molecular Construction
-
N-term
-
PAX8 (P2-S146)
Accession # Q06710 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PAX8; PAX-8; Paired Box 8; Paired Domain Gene 8; Paired Box Protein Pax-8; Paired Box Gene 8
-
AA Sequence
PHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
