PAX8 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PAX8 protein, a crucial transcription factor, is essential for thyroid-specific gene expression, maintaining the functional differentiation of thyroid cells. It plays a pivotal role in regulating the thyroid-specific gene profile, contributing to specialized thyroid cell function. PAX8 also interacts with WWTR1, indicating a potential partnership in modulating gene expression and cellular processes in thyroid cells. PAX8 Protein, Human (His) is the recombinant human-derived PAX8 protein, expressed by E. coli , with C-His labeled tag.

Background

The PAX8 protein operates as a transcription factor essential for the thyroid-specific expression of genes exclusive to thyroid cells, thereby preserving the functional differentiation of these cells. PAX8 plays a pivotal role in regulating the thyroid-specific gene expression profile, contributing to the specialized function of thyroid cells. Additionally, PAX8 interacts with WWTR1, suggesting a potential partnership in modulating gene expression and cellular processes within the thyroid cell type.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PAX8 (P2-S146)
      Accession # Q06710
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PAX8; PAX-8; Paired Box 8; Paired Domain Gene 8; Paired Box Protein Pax-8; Paired Box Gene 8

  • AA Sequence

    PHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDS

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00