PDE3A Protein, Human (sf9, His-GST)

PDE3A protein, a cyclic nucleotide phosphodiesterase, targets cAMP, cGMP, and cUMP, crucial in diverse physiological processes. In an E2/17beta-estradiol-induced pro-apoptotic pathway, E2 stabilizes the PDE3A/SLFN12 complex, leading to SLFN12 dephosphorylation and activating its pro-apoptotic ribonuclease activity. This pathway is implicated in tissues with high E2 concentrations, potentially contributing to processes like placenta remodeling. PDE3A Protein, Human (sf9, His-GST) is the recombinant human-derived PDE3A protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

PDE3A protein, a cyclic nucleotide phosphodiesterase, exhibits specificity for the second messengers cAMP and cGMP, crucial regulators in diverse physiological processes. Additionally, PDE3A demonstrates activity toward cUMP. Beyond its catalytic role, PDE3A is a component of an E2/17beta-estradiol-induced pro-apoptotic signaling pathway. Estradiol (E2) stabilizes the PDE3A/SLFN12 complex in the cytosol, leading to the dephosphorylation of SLFN12 and activation of its pro-apoptotic ribonuclease activity. This apoptotic pathway is implicated in tissues with high concentrations of E2 and may play a role in processes such as placenta remodeling.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

N-His;N-GST

Q14432 (K669-Q1141)

5139  [NCBI]

Partial

KPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPDQ

Approximately 93 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol, 3 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.