Copy Link Print Information

PDE3A Protein, Human (sf9, His-GST)

Customer Review

Based on 1 Customer Validation

PDE3A protein, a cyclic nucleotide phosphodiesterase, targets cAMP, cGMP, and cUMP, crucial in diverse physiological processes. In an E2/17beta-estradiol-induced pro-apoptotic pathway, E2 stabilizes the PDE3A/SLFN12 complex, leading to SLFN12 dephosphorylation and activating its pro-apoptotic ribonuclease activity. This pathway is implicated in tissues with high E2 concentrations, potentially contributing to processes like placenta remodeling. PDE3A Protein, Human (sf9, His-GST) is the recombinant human-derived PDE3A protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PDE3A Protein, Human (sf9, His-GST)
  • PDE3A Protein, Human (sf9, His-GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDE3A protein, a cyclic nucleotide phosphodiesterase, targets cAMP, cGMP, and cUMP, crucial in diverse physiological processes. In an E2/17beta-estradiol-induced pro-apoptotic pathway, E2 stabilizes the PDE3A/SLFN12 complex, leading to SLFN12 dephosphorylation and activating its pro-apoptotic ribonuclease activity. This pathway is implicated in tissues with high E2 concentrations, potentially contributing to processes like placenta remodeling. PDE3A Protein, Human (sf9, His-GST) is the recombinant human-derived PDE3A protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

PDE3A protein, a cyclic nucleotide phosphodiesterase, exhibits specificity for the second messengers cAMP and cGMP, crucial regulators in diverse physiological processes. Additionally, PDE3A demonstrates activity toward cUMP. Beyond its catalytic role, PDE3A is a component of an E2/17beta-estradiol-induced pro-apoptotic signaling pathway. Estradiol (E2) stabilizes the PDE3A/SLFN12 complex in the cytosol, leading to the dephosphorylation of SLFN12 and activation of its pro-apoptotic ribonuclease activity. This apoptotic pathway is implicated in tissues with high concentrations of E2 and may play a role in processes such as placenta remodeling.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession

    Q14432 (K669-Q1141)

  • Gene ID
    5139  [NCBI]
  • Protein Length

    Full Length of Interaction with SLFN12 Region

  • Synonyms

    PDE3A; CGMP-Inhibited CAMP Phosphodiesterase; Phosphodiesterase 3A; Phosphodiesterase 3A, CGMP-Inhibited; CGI-PDE; CGI-PDE A; CGMP-Inhibited 3',5'-Cyclic Phosphodiesterase 3A; CAMP Phosphodiesterase, Myocardial CGMP-Inhibited; CGMP-Inhibited 3',5'-Cyclic

  • AA Sequence

    KPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDHPGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPDQ

  • Molecular Weight

    Approximately 93 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol, 3 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • PDE3A Protein, Human (sf9, His-GST) Product Image
    1/16
  • Experimental Validation Results for PDE3A Protein, Human (sf9, His-GST)
  • PDE3A Protein, Human (sf9, His-GST) Product Image