Copy Link Print Information

PDGF-CC Protein, Cynomolgus (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PDGF-CC Protein, Cynomolgus (HEK293, hFc)
  • Experimental Validation Results for PDGF-CC Protein, Cynomolgus (HEK293, hFc)
  • PDGF-CC Protein, Cynomolgus (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which plays an important roll in normal skeleton formation and normal skin morphogenesis during embryonic development, wound healing, angiogenesis and blood vessel development as well as being involved in fibrotic processes. PDGF-CC Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Platelet derived growth factor C (PDGF-CC) is a growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGF-CC is a potent mitogen and chemoattractant for cells of mesenchymal origin which is required for normal skeleton formation during embryonic development, especially for normal development of the craniofacial skeleton and for normal development of the palate. PDGF-CC is also required for normal skin morphogenesis during embryonic development. PDGF-CC plays an important role in wound healing, where it appears to be involved in three stages: inflammation, proliferation and remodeling. PDGF-CC plays an important role in angiogenesis and blood vessel development and is involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. The CUB domain of PDGF-CC has mitogenic activity in coronary artery smooth muscle cells[1][2][3].

Verified Bioactivity

Measured in a cell proliferation assay using NIH/3T3 cells. The ED50 for this effect is 15.09 ng/mL, corresponding to a specific activity is 66269.052 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH/3T3 cells. The ED50 for this effect is 15.09 ng/mL, corresponding to a specific activity is 66269.052 units/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-hFc
  • Accession

    EHH54037 (V196-G306)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • hFc
    • PDGF-CC (V196-G306)
      Accession # EHH54037
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFC; Platelet-Derived Growth Factor C; Platelet Derived Growth Factor C; PDGF-C; Fallotein; VEGF-E; SCDGF; Secretory Growth Factor-Like Protein; Spinal Cord-Derived Growth Factor

  • AA Sequence

    VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

  • Predicted Molecular Mass

    40.9 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH/3T3 cells. The ED50 for this effect is 15.09 ng/mL, corresponding to a specific activity is 66269.052 units/mg.

  • PDGF-CC Protein, Cynomolgus (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for PDGF-CC Protein, Cynomolgus (HEK293, hFc)
  • Experimental Validation Results for PDGF-CC Protein, Cynomolgus (HEK293, hFc)
  • PDGF-CC Protein, Cynomolgus (HEK293, hFc) Product Image