PDGF-AA Protein, Canine (P.pastoris, His)

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGFAA enables growth factor activity and platelet-derived growth factor receptor binding. PDGFAA is involved in platelet-derived growth factor receptor signaling pathway, positive regulation of MAP kinase activity and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction^[1][2][3].

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED₅₀ for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.

Canine

P. pastoris

N-8*His

NP_001177101 (S87-R196)

491597  [NCBI]

Partial

SIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCTTSGLNPDHREEETDVR

Approximately 15-20 kDa & 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Demaria M, et al. An essential role for senescent cells in optimal wound healing through secretion of PDGF-AA. Dev Cell. 2014 Dec 22;31(6):722-33.  [Content Brief]

  [2]. Takada A, et al. Two novel NKG2D ligands of the mouse H60 family with differential expression patterns and binding affinities to NKG2D. J Immunol. 2008 Feb 1;180(3):1678-85.  [Content Brief]

  [3]. Hamerman JA, et al. Cutting edge: Toll-like receptor signaling in macrophages induces ligands for the NKG2D receptor. J Immunol. 2004 Feb 15;172(4):2001-5.  [Content Brief]