PDGF-AA Protein, Canine (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGFAA enables growth factor activity and platelet-derived growth factor receptor binding. PDGFAA is involved in platelet-derived growth factor receptor signaling pathway, positive regulation of MAP kinase activity and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction[1][2][3].

Verified Bioactivity

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.

Technical Parameters

  • Species Canine
  • Source P. pastoris
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • PDGFAA (S87-R196)
      Accession # NP_001177101
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu

  • AA Sequence

    SIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCTTSGLNPDHREEETDVR

  • Predicted Molecular Mass

    13.6 kDa

  • Molecular Weight

    Approximately 15-20 kDa & 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00