1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-A
  6. PDGF-AA Protein, Canine (P.pastoris, His)

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.

Background

PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGFAA enables growth factor activity and platelet-derived growth factor receptor binding. PDGFAA is involved in platelet-derived growth factor receptor signaling pathway, positive regulation of MAP kinase activity and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction[1][2][3].

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.
Species

Canine

Source

P. pastoris

Tag

N-8*His

Accession

NP_001177101 (S87-R196)

Gene ID
Molecular Construction
N-term
8*His
PDGFAA (S87-R196)
Accession # NP_001177101
C-term
Protein Length

Partial

Synonyms
Platelet-derived growth factor subunit A; PDGF-1; PDGF-A; Rpa1
AA Sequence

SIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCTTSGLNPDHREEETDVR

Predicted Molecular Mass
13.6 kDa
Molecular Weight

Approximately 15-20 kDa & 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PDGF-AA Protein, Canine (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDGF-AA Protein, Canine (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-AA Protein, Canine (P.pastoris, His)
Cat. No.:
HY-P75965
Quantity:
MCE Japan Authorized Agent: