PDGF-AA Protein, Canine (P.pastoris, His)
Based on 1 Customer Validation
PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Canine
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGF-AA Protein, Canine (P.pastoris, His) is the recombinant canine-derived PDGFAA protein, expressed by P. pastoris , with N-His labeled tag.
Background
PDGFAA Protein is platelet-derived growth factor subunit A precursor. PDGFAA enables growth factor activity and platelet-derived growth factor receptor binding. PDGFAA is involved in platelet-derived growth factor receptor signaling pathway, positive regulation of MAP kinase activity and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction[1][2][3].
Verified Bioactivity
Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 97.71 ng/mL, corresponding to a specific activity is 1.02×104 units/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Canine
-
Source P. pastoris
-
Tag N-8*His
-
Accession
NP_001177101 (S87-R196)
-
Molecular Construction
-
N-term
-
8*His
-
PDGFAA (S87-R196)
Accession # NP_001177101 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PDGFA; Platelet-Derived Growth Factor Alpha Chain; Platelet Derived Growth Factor Subunit A; Platelet-Derived Growth Factor A Chain; Platelet-Derived Growth Factor Alpha Polypeptide; PDGF Subunit A; PDGF1; PDGF A-Chain; Platelet-Derived Growth Factor Subu
-
AA Sequence
SIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCAGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECTCTTSGLNPDHREEETDVR
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 15-20 kDa & 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Demaria M, et al. An essential role for senescent cells in optimal wound healing through secretion of PDGF-AA. Dev Cell. 2014 Dec 22;31(6):722-33. [Content Brief]
[2]. Takada A, et al. Two novel NKG2D ligands of the mouse H60 family with differential expression patterns and binding affinities to NKG2D. J Immunol. 2008 Feb 1;180(3):1678-85. [Content Brief]
[3]. Hamerman JA, et al. Cutting edge: Toll-like receptor signaling in macrophages induces ligands for the NKG2D receptor. J Immunol. 2004 Feb 15;172(4):2001-5. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
