Pepsinogen C/PGC Protein, Human (His)
Pepsinogen C/PGC protein hydrolyzes various proteins, playing a crucial role in digestion by breaking them down into smaller peptides. Its proficiency in protein hydrolysis contributes to the initial stages of digestion, making it vital in the overall digestive cascade. Pepsinogen C/PGC Protein, Human (His) is the recombinant human-derived Pepsinogen C/PGC protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Pepsinogen C/PGC protein hydrolyzes various proteins, playing a crucial role in digestion by breaking them down into smaller peptides. Its proficiency in protein hydrolysis contributes to the initial stages of digestion, making it vital in the overall digestive cascade. Pepsinogen C/PGC Protein, Human (His) is the recombinant human-derived Pepsinogen C/PGC protein, expressed by E. coli , with N-His labeled tag.
Background
Pepsinogen C, also known as PGC protein, serves as a key enzyme with the ability to hydrolyze a diverse range of proteins. This enzymatic activity underscores its crucial role in the digestive process, as it participates in breaking down proteins into smaller peptides. PGC's proficiency in protein hydrolysis contributes significantly to the initial stages of digestion, playing a vital role in the overall digestive cascade.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P20142-1/NP_002621.1 (I153-I239)
-
Molecular Construction
-
N-term
-
His
-
PGC (I153-I239)
Accession # P20142-1/NP_002621.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PGC; Pepsinogen Group II; Progastricsin; Preprogastricsin; Pepsinogen C; Pepsin C; Gastricsin; PEPC; Progastricsin (Pepsinogen C); PGII
-
AA Sequence
IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI
-
Predicted Molecular Mass
10.9 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
