1. Recombinant Proteins
  2. Others
  3. Pepsinogen C/PGC Protein, Human (His)

Pepsinogen C/PGC protein hydrolyzes various proteins, playing a crucial role in digestion by breaking them down into smaller peptides. Its proficiency in protein hydrolysis contributes to the initial stages of digestion, making it vital in the overall digestive cascade. Pepsinogen C/PGC Protein, Human (His) is the recombinant human-derived Pepsinogen C/PGC protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Pepsinogen C/PGC protein hydrolyzes various proteins, playing a crucial role in digestion by breaking them down into smaller peptides. Its proficiency in protein hydrolysis contributes to the initial stages of digestion, making it vital in the overall digestive cascade. Pepsinogen C/PGC Protein, Human (His) is the recombinant human-derived Pepsinogen C/PGC protein, expressed by E. coli , with N-His labeled tag.

Background

Pepsinogen C, also known as PGC protein, serves as a key enzyme with the ability to hydrolyze a diverse range of proteins. This enzymatic activity underscores its crucial role in the digestive process, as it participates in breaking down proteins into smaller peptides. PGC's proficiency in protein hydrolysis contributes significantly to the initial stages of digestion, playing a vital role in the overall digestive cascade.

Species

Human

Source

E. coli

Tag

N-His

Accession

P20142-1/NP_002621.1 (I153-I239)

Gene ID
Molecular Construction
N-term
His
PGC (I153-I239)
Accession # P20142-1/NP_002621.1
C-term
Protein Length

Partial

Synonyms
Gastricsin; Pepsinogen C; PGC; PEPC
AA Sequence

IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI

Predicted Molecular Mass
10.9 kDa
Molecular Weight

Approximately 10 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Documentation

Pepsinogen C/PGC Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Pepsinogen C/PGC Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pepsinogen C/PGC Protein, Human (His)
Cat. No.:
HY-P77131
Quantity:
MCE Japan Authorized Agent: