Peroxiredoxin-2/PRDX2 Protein, Human (sf9, His)

Peroxiredoxin-2 (PRDX2) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides, which is essential for cellular protection against oxidative stress. It detoxifies peroxide, senses hydrogen peroxide-mediated signaling events, and may participate in signaling cascades initiated by growth factors and tumor necrosis factor-alpha. Peroxiredoxin-2/PRDX2 Protein, Human (sf9, His) is the recombinant human-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Peroxiredoxin-2 (PRDX2), a thiol-specific peroxidase, serves as a catalyst in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its vital role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX2 may also participate in the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular concentrations of H(2)O(2). This versatile protein underscores its significance in cellular redox regulation and stress response pathways.

Measured by its ability to reduce H₂O₂ and the specific activity is >300 pmoles/min/μg.

Human

Sf9 insect cells

N-His

P32119-1 (M1-N198)

7001  [NCBI]

Full Length

MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.