PRDX5/Peroxiredoxin-5 Protein, Human (His)

The PRDX5 protein (or Peroxiredoxin-5) plays a critical role as a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides. This enzyme activity is essential for cells to defend against oxidative stress and detoxify peroxides. PRDX5/Peroxiredoxin-5 Protein, Human (His) is the recombinant human-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

PRDX5, also known as Peroxiredoxin-5, serves as a thiol-specific peroxidase, facilitating the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This enzymatic activity is integral to the cellular defense against oxidative stress, functioning as a protective mechanism by detoxifying peroxides. Beyond its role in peroxide reduction, PRDX5 acts as a sensor for hydrogen peroxide-mediated signaling events, highlighting its involvement in cellular signaling pathways associated with oxidative stress responses. The multifaceted functions of PRDX5 underscore its significance in maintaining cellular homeostasis and orchestrating adaptive responses to oxidative challenges.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His

P30044-1 (M53-L214)

25824  [NCBI]

Full Length of Isoform-1 Mature Protein

MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Approximately 18.5 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.