PFKFB2 Protein, Human (sf9, GST)
PFKFB2 Protein, Human (sf9, GST) is the recombinant human-derived PFKFB2, expressed by Sf9 insect cells , with GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PFKFB2 Protein, Human (sf9, GST) is the recombinant human-derived PFKFB2, expressed by Sf9 insect cells , with GST labeled tag. ,
Background
PFKFB2 is a key enzyme involved in the synthesis and degradation of fructose 2,6-bisphosphate. It regulates the balance between glycolysis and gluconeogenesis pathways by controlling fructose 2,6-bisphosphate levels. by similar: Other PFKFB family members (e.g., PFKFB1, PFKFB3) share analogous metabolic regulatory roles but exhibit differences in tissue distribution and specific functions.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
O60825-1 (M1-D505)
-
Gene ID5208
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PFKFB2; PFK/FBPase 2; 6-Phosphofructo-2-Kinase/Fructose-2,6-Biphosphatase 2; Fructose-2,6-Bisphosphatase, Cardiac Isozyme; 6-Phosphofructo-2-Kinase/Fructose-2,6-Bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ASE Heart-Type Isozyme; 6PF-2-K/Fru-2,6-P2ase Heart-Type I
-
AA Sequence
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD
-
Molecular Weight
Approximately 84 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
