PGAM5 Protein, Human (His)
Based on 1 Customer Validation
PGAM5 Protein, Human (His) is the recombinant human-derived PGAM5, expressed by E. coli , with C-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PGAM5 Protein, Human (His) is the recombinant human-derived PGAM5, expressed by E. coli , with C-6*His labeled tag. ,
PGAM5 is a mitochondrial serine/threonine phosphatase that dephosphorylates various substrates, playing roles in processes like cellular senescence and mitophagy. It modulates mitochondrial dynamics by dephosphorylating DNM1L/DRP1 to promote fission and stress-sensitively dephosphorylating MFN2 to protect it from ubiquitination, aiding mitochondrial network formation. Independently of PARKIN, it regulates mitophagy by interacting with and dephosphorylating FUNDC1 (which binds LC3). PGAM5 also forms a tertiary complex with KEAP1 and NRF2 to regulate anti-oxidative responses, and acts as a RIPK3 target to recruit the RIPK1-RIPK3-MLKL necrosome to mitochondria, controlling necroptosis.
Human PGAM5 immobilized on CM5 Chip can bind LFHP-1c with an affinity constant of 425.8 nM as determined in a SPR assay.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q96HS1-1 (K30-S289)
-
Gene ID192111
-
Protein Length
Partial
-
Synonyms
PGAM5; BXLBv68; PGAM Family Member 5, Mitochondrial Serine/Threonine Protein Phosphatase; PGAM Family Member 5, Serine/Threonine Protein Phosphatase, Mitochondrial; Phosphoglycerate Mutase Family Member 5; MGC5352; Serine/Threonine-Protein Phosphatase PGA
-
AA Sequence
KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
-
Molecular Weight
Approximately 31-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
