PGAM5 Protein, Human (His)

PGAM5 Protein, Human (His) is the recombinant human-derived PGAM5, expressed by E. coli , with C-6*His labeled tag. ,

PGAM5 is a mitochondrial serine/threonine phosphatase that dephosphorylates various substrates, playing roles in processes like cellular senescence and mitophagy. It modulates mitochondrial dynamics by dephosphorylating DNM1L/DRP1 to promote fission and stress-sensitively dephosphorylating MFN2 to protect it from ubiquitination, aiding mitochondrial network formation. Independently of PARKIN, it regulates mitophagy by interacting with and dephosphorylating FUNDC1 (which binds LC3). PGAM5 also forms a tertiary complex with KEAP1 and NRF2 to regulate anti-oxidative responses, and acts as a RIPK3 target to recruit the RIPK1-RIPK3-MLKL necrosome to mitochondria, controlling necroptosis.

Human PGAM5 immobilized on CM5 Chip can bind LFHP-1c with an affinity constant of 425.8 nM as determined in a SPR assay.

• 
  Human PGAM5 immobilized on CM5 Chip can bind LFHP-1c with an affinity constant of 425.8 nM as determined in a SPR assay.

Human

E. coli

C-6*His

Q96HS1-1 (K30-S289)

192111

Partial

KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

31-40 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.