Copy Link Print Information

PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response.It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms.PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections.Understanding its functions can aid in developing strategies to combat bacterial pathogens.PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)
  • PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response.It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms.PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections.Understanding its functions can aid in developing strategies to combat bacterial pathogens.PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag.

Background

PGLYRP1/PGRP-S, an innate immunity protein, serves multifaceted roles in antimicrobial and antitumor defense systems. Functioning as a pattern receptor, it binds to murein peptidoglycans (PGN) from Gram-positive bacteria, thereby exerting bactericidal activity. Additionally, it forms an equimolar complex with heat shock protein HSPA1A, triggering programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor. Collaborating with the Ca(2+)-binding protein S100A4, it acts as a chemoattractant that induces lymphocyte movement and activates lymphocytes to eliminate virus-infected and tumor cells. The induction of cytotoxicity on monocyte surfaces requires interaction with the TREM1 receptor. This protein exhibits a homodimeric structure linked by disulfide bonds and interacts intricately with HSPA1A and HSPBP1, modulating its cytotoxic activity. These versatile functions underscore the critical involvement of PGLYRP1/PGRP-S in immune response and defense mechanisms.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized Peptidoglycan at 5 μg/mL (100 μL/well) on the plate can bind Mouse PGLYRP1. The ED50 for this effect is 24.56 ng/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized Peptidoglycan at 5 μg/mL (100 μL/well) on the plate can bind Biotinylated Mouse PGLYRP1. The ED50 for this effect is < 30 ng/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Peptidoglycan at 5 μg/mL (100 μL/well) on the plate can bind Mouse PGLYRP1. The ED50 for this effect is 24.56 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    O88593 (F19-E182)

  • Gene ID
    21946  [NCBI]
  • Molecular Construction
    • N-term
    • PGLYRP1 (F19-E182)
      Accession # O88593
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PGLYRP1; PGRPS; Prev. TNFSF3L; TNF Superfamily, Member 3 (LTB)-Like (Peptidoglycan Recognition Protein); Prev. PGLYRP; Peptidoglycan Recognition Protein Short; PGRP-S; Peptidoglycan Recognition Protein; PGRP; Peptidoglycan Recognition Protein 1; TAG7

  • AA Sequence

    FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE

  • Molecular Weight

    Approximately 18-21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM MOPS, 150 mM NaCl, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Peptidoglycan at 5 μg/mL (100 μL/well) on the plate can bind Mouse PGLYRP1. The ED50 for this effect is 24.56 ng/mL.

  • PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PGLYRP1/PGRP-S Protein, Mouse (HEK293, His)
  • PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) Product Image