PLAU/uPA Protein, Human (Biotinylated, HEK293, His-Avi)
uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
uPA chain A Protein, a key player in the plasminogen activation system, selectively cleaves plasminogen, initiating fibrinolysis and contributing to tissue remodeling. Its precision underscores its role in regulating proteolytic activity, emphasizing its significance in the cascade of events leading to fibrinolysis and extracellular matrix remodeling in various physiological processes. PLAU/uPA Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PLAU/uPA protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
Background
uPA chain A, a key player in the plasminogen activation system, performs a critical role as it selectively cleaves the zymogen plasminogen to generate the enzymatically active form known as plasmin. This proteolytic activation is a pivotal step in fibrinolysis, where plasmin functions to degrade fibrin clots and contribute to tissue remodeling and repair. uPA chain A's precision in cleaving plasminogen underscores its significance in regulating the delicate balance of proteolytic activity, emphasizing its role as a key initiator in the cascade of events leading to fibrinolysis and other physiological processes involving extracellular matrix remodeling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P00749-1 (S21-L431)
-
Molecular Construction
-
N-term
-
PLAU (S21-L431)
Accession # P00749-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Conjugation
Biotin
-
Synonyms
PLAU; Plasminogen Activator, Urinary; Plasminogen Activator, Urokinase; PLAU Protein; UPA; BDPLT5; Urokinase-Type Plasminogen Activator; U-PA; URK; ATF; U-Plasminogen Activator; QPD
-
AA Sequence
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
-
Predicted Molecular Mass
49.3 kDa
-
Molecular Weight
Approximately 23-27 kDa & 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
