PLXNA1 Protein, Human (His)
PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag.
Background
PLXNA1 protein serves as a coreceptor for SEMA3A, SEMA3C, SEMA3F, and SEMA6D, playing an essential role in signaling by class 3 semaphorins and subsequent cytoskeleton remodeling. It is integral to processes such as axon guidance, invasive growth, and cell migration. In the presence of class 3 semaphorins, PLXNA1 forms a complex with a neuropilin, and this interaction modulates the affinity of the complex for specific semaphorins. The cytoplasmic domain of PLXNA1 is crucial for activating downstream signaling events within the cytoplasm. Notably, the protein interacts directly with neuropilins NRP1 and NRP2, and it also engages with FARP2, RND1, and KDR/VEGFR2. The binding of SEMA3A to PLXNA1 leads to the dissociation of FARP2, highlighting the intricate regulatory role of PLXNA1 in semaphorin-mediated cellular responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9UIW2 (L986-L1152)
-
Molecular Construction
-
N-term
-
His
-
PLXNA1 (L986-L1152)
Accession # Q9UIW2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PLXNA1; PLEXIN-A1; Prev. PLXN1; Plexin 1; NOV; DWOPNED; Semaphorin Receptor NOV; NOVP; Plexin A1; Plexin-A1
-
AA Sequence
LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL
-
Predicted Molecular Mass
22.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
