PNMT Protein, Dog (Active, sf9, GST)
PNMT Protein, Dog (Active, sf9, GST) is the recombinant dog-derived PNMT, expressed by Sf9 insect cells , with GST labeled tag. ,
- Species: Dog
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PNMT Protein, Dog (Active, sf9, GST) is the recombinant dog-derived PNMT, expressed by Sf9 insect cells , with GST labeled tag. ,
Technical Parameters
-
Species Dog
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
XM_548143 (M1-V291)
-
Gene ID491023
-
Protein Length
Full Length
-
Synonyms
PNMT; Noradrenaline N-Methyltransferase; Prev. PENT; Phenylethanolamine N-Methylase; Phenylethanolamine N-Methyltransferase; PNMTase
-
AA Sequence
MSAAAPSPAAGAAPDAAPDAAPDAARGREAVASAYQRFEPRAYLRNNYAPPRGDLSSPDGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTIYQLLSACTHFEDITMTDFLEVNRQELGLWLREEPGALDWSMYSQRVCIMEGKGESWREKERQLRARVKRVLHIDVHQPQPLGAGNLAPLPADALVSAFCLEAVSPDLPSFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLVVVPVCKEEVMEALVRSGYEVRDLRTYIMPACLQTGVDDVKGIFFAWAQKKEGV
-
Molecular Weight
Approximately 59 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
