PP1MG Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PP1MG Protein, a member of PPM family of serine/threonine phosphatases, has an important role in controlling cell cycle progression. PP1MG Proteinregulates the phosphorylation of SRSF3 in hepatocellular carcinoma (HCC) and contributes to the proliferation, invasion, and metastasis of HCC. PP1MG Protein forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641, which is necessary for the appropriate assembly of adherens junctions and the prevention of aberrant cell migration. PP1MG Protein, Human (His) is the recombinant human-derived PP1MG protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PP1MG Protein, a member of PPM family of serine/threonine phosphatases, has an important role in controlling cell cycle progression. PP1MG Proteinregulates the phosphorylation of SRSF3 in hepatocellular carcinoma (HCC) and contributes to the proliferation, invasion, and metastasis of HCC. PP1MG Protein forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641, which is necessary for the appropriate assembly of adherens junctions and the prevention of aberrant cell migration[1][2]. PP1MG Protein, Human (His) is the recombinant human-derived PP1MG protein, expressed by E. coli , with C-6*His labeled tag.

Background

PPM phosphatase family consists of at least 17 members. PPM phosphatases are dependent on Mg2+ or Mn2+ ions for their activity. PP1MG Protein, Human (His) forms a distinct holoenzyme complex with the PP2A regulatory subunit B56δ. B56δ promotes the re‐localization of PPM1G to the cytoplasm where the phosphatase can access a discrete set of substrates.α‐catenin, a component of adherens junction, as a new substrate for the PPM1G‐B56 phosphatase complex in the cytoplasm. B56δ‐PPM1G dephosphorylates α‐catenin at serine 641[1].
Overexpression of PPM1G promotes the dephosphorylation of SRSF3 and changes the alternative splicing patterns of genes related to the cell cycle, the transcriptional regulation in HCC cells. The knockdown of PPM1G inhibited tumor growth in vivo[2].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PP1MG (M317-D546)
      Accession # O15355
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPM1G; Protein Phosphatase 1G (Formerly 2C), Magnesium-Dependent, Gamma Isoform; Protein Phosphatase, Mg2+/Mn2+ Dependent 1G; Protein Phosphatase, Mg2+/Mn2+ Dependent, 1G; Protein Phosphatase 1G; Protein Phosphatase 2C, Gamma Isoform; PP2Cgamma; Protein P

  • AA Sequence

    MEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD

  • Predicted Molecular Mass

    26.2 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 25 mM Tris-HCl, 1 mM DTT, 1 mM EDTA, 2 mM β-ME, 20% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00