PPAR alpha Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
PPAR alpha Protein, Mouse (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PPAR alpha Protein, Mouse (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.
Background
Peroxisome proliferator-activated receptors (PPARs) are ligand-dependent transcription factors that belong to the nuclear receptor superfamily comprising 48 members in human. PPARs include three subtypes, PPARα, PPARγ, and PPARδ. PPARα is involved in lipid homeostasis by regulating the transcription of sets of genes related to lipid metabolism and thereby reducing blood triglyceride levels. PPARα has attracted attention as a target for hypolipidemic drugs[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
2025 Nov:147:157159. PMID: 40834610
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P23204 (T200-Y468)
-
Gene ID19013
-
Molecular Construction
-
N-term
-
6*His
-
PPAR alpha (T200-Y468)
Accession # P23204 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PPARA; HPPAR; Prev. PPAR; PPAR-Alpha; Peroxisome Proliferator-Activated Receptor Alpha; Alternative Protein PPARA; NR1C1; PPARalpha; Nuclear Receptor Subfamily 1 Group C Member 1; Peroxisome Proliferator Activated Receptor Alpha; Peroxisome Proliferative
-
AA Sequence
TADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFVIHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
-
Predicted Molecular Mass
31.4 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)