1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Peroxisome Proliferator-activated Receptor
  5. PPAR gamma
  6. PPAR gamma Protein, Human (His)

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: Cell Rep Med. 2025 Sep 26:102373.  [Abstract]

    The surface plasmon resonance (SPR) analysis of UDCA (200, 400, 600, 800, and 1,000 μM) binding to the recombinant human PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999). The SPR analysis was performed using the PlexArray HT System and 3D Dextran sensor chip. The recombinant human PPARγ protein (PPAR gamma Protein, Human (His)) was immobilized on the chip surface and activated with 10 mM NiSO4. The results showed that the UDCA bound directly to the PPARγ protein with an equilibrium dissociation constant of 1.82 × 10 −8 M, exhibiting a strong binding affinity.

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: Phytomedicine. 2025 Aug 27:147:157213.  [Abstract]

    Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: Ecotoxicol Environ Saf. 2025 Nov 15:307:119433.  [Abstract]

    In vitro, the interactions between recombinant PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999, 100 μg/mL, immobilized on activated CM5 chip at 10 μL/min for 420 s) and four chemicals that induce pulmonary fibrosis were analyzed using surface plasmon resonance (SPR) under varying dose-time gradients. The results showed that the KD for PPARγ and amiodarone was 25.77 µM, whereas that of bleomycin was 317.2 nM, indicating concentration-dependent binding despite an observed negative response after subtraction. Busulfan exhibited a KD of 2.311 µM, and cisplatin displayed a KD of 878.9 nM, confirming their dose-dependent binding.

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: Life Med. 2024 Jun 28;3(3):lnae025.  [Abstract]

    Real-time kinetic binding sensorgrams and equilibrium binding signals of CA1 (25–400 µM) and CA2 (2.5–40 µM) were shown. Response (nm) indicates the optical thickness on the NTA biosensor layer. Tresults confirmed that CA1 and CA2 can interact directly and reversibly with PPARγ (PPAR gamma Protein, Human (His), HY-P7999, 50 mg/mL), with dissociation constants (KD) of 75.33 μM and 32.36 μM, respectively. This binding exhibits prominent concentration dependence, and the optical thickness (nm) of the sensing layer increases gradually with the rise in compound concentration.

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: FEBS J. 2024 Oct;291(20):4581-4601.  [Abstract]

    The binding of GDH1 to PPARγ (PPAR gamma Protein, Human (His), HY-P7999) was measured using BIAcore system. The KD value of GDH1 with PPARγ was 4.0×10−10 M, which suggested a strong binding of GDH1 to PPARγ.

    PPAR gamma Protein, Human (His) purchased from MCE. Usage Cited in: Phytomedicine. 2023 Dec:121:155116.  [Abstract]

    SPR assays for the interaction between astragaloside IV and PPARγ (PPAR alpha Protein, Human (His), HY-P7996).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

    Background

    The peroxisome proliferator-activated receptor (PPAR) belongs to the nuclear receptor superfamily and plays an important role in the regulation of the storage and catabolism of dietary fats. PPAR contains three subtypes, PPARα, PPARβand PPARγ[1].
    Many naturally occurring molecules such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites can bind and activate PPARgamma[2].
    LBD is the ligand binding domain (LBD) of PPARgamma, His-taged LBD can be used for the study of ligand screening assays, western blotting, and ELISA, et al.

    In Vitro

    PPAR gamma Protein, Human (His) can be used in SPR assay or BLI assay for detection of molecules interactions[3][4].

    Biological Activity

    1. PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
    2. Measured by its binding ability in a functional ELISA. Immobilized GW9662 (HY-P16578) at 20 μg/mL (100 μ L/well) on the plate can bind Biotinylated Human PPAR gamma. The ED50 for this effect is 1.685 μg/mL.

    • PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
    Species

    Human

    Source

    E. coli

    Tag

    N-6*His

    Accession

    P37231-1 (D238-D503)

    Gene ID
    Molecular Construction
    N-term
    6*His
    PPAR gamma (D238-D503)
    Accession # P37231-1
    C-term
    Protein Length

    Partial

    Synonyms
    PPAR-γ-LBD
    AA Sequence

    DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

    Molecular Weight

    Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 90%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, pH 7.4, 8% trehalose.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    PPAR gamma Protein, Human (His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    PPAR gamma Protein, Human (His)
    Cat. No.:
    HY-P7999
    Quantity:
    MCE Japan Authorized Agent: