1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear receptor superfamily
  4. PPARs
  5. PPAR gamma Protein, Human (His)

PPAR gamma Protein, Human (His)

Cat. No.: HY-P7999
Handling Instructions

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $85 Get quote
50 μg $200 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE PPAR gamma Protein, Human (His)

PPAR gamma Protein, Human (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Accession

P37231 (238D-503D)

Gene ID

5468

Synonyms
PPAR-γ-LBD
AA Sequence

MGSSHHHHHHSSGLVPRGSHDLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Weight

Approximately 32.6 kDa

Purity

>90%

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of PBS, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

The peroxisome proliferator-activated receptor (PPAR) belongs to the nuclear receptor superfamily and plays an important role in the regulation of the storage and catabolism of dietary fats. PPAR contains three subtypes, PPARα, PPARβand PPARγ[1].
Many naturally occurring molecules such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites can bind and activate PPARgamma[2].
LBD is the ligand binding domain (LBD) of PPARgamma, His-taged LBD can be used for the study of ligand screening assays, western blotting, and ELISA, et al.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPAR gamma Protein, Human (His)
Cat. No.:
HY-P7999
Quantity:
MCE Japan Authorized Agent: