PPAR gamma Protein, Human (His)

8 Cited Publications
Customer Review

Based on 8 publication(s) in Google Scholar

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

Background

The peroxisome proliferator-activated receptor (PPAR) belongs to the nuclear receptor superfamily and plays an important role in the regulation of the storage and catabolism of dietary fats. PPAR contains three subtypes, PPARα, PPARβand PPARγ[1].
Many naturally occurring molecules such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites can bind and activate PPARgamma[2].
LBD is the ligand binding domain (LBD) of PPARgamma, His-taged LBD can be used for the study of ligand screening assays, western blotting, and ELISA, et al.

In Vitro

PPAR gamma Protein, Human (His) can be used in SPR assay or BLI assay for detection of molecules interactions[3][4].

Verified Bioactivity

1. PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
2. Measured by its binding ability in a functional ELISA. Immobilized GW9662 (HY-P16578) at 20 μg/mL (100 μ L/well) on the plate can bind Biotinylated Human PPAR gamma. The ED50 for this effect is 1.685 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PPAR gamma (D238-D503)
      Accession # P37231-1
    • C-term
  • Protein Length

    Full Length of NR LBD domain

  • Synonyms

    PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferato

  • AA Sequence

    DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

  • Molecular Weight

    Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00