Copy Link Print Information

PPAR gamma Protein, Human (His)

8 Cited Publications
Customer Review

Based on 8 publication(s) in Google Scholar

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • PPAR gamma Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

Background

The peroxisome proliferator-activated receptor (PPAR) belongs to the nuclear receptor superfamily and plays an important role in the regulation of the storage and catabolism of dietary fats. PPAR contains three subtypes, PPARα, PPARβand PPARγ[1].
Many naturally occurring molecules such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites can bind and activate PPARgamma[2].
LBD is the ligand binding domain (LBD) of PPARgamma, His-taged LBD can be used for the study of ligand screening assays, western blotting, and ELISA, et al.

In Vitro

PPAR gamma Protein, Human (His) can be used in SPR assay or BLI assay for detection of molecules interactions[3][4].

Verified Bioactivity

1. PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
2. Measured by its binding ability in a functional ELISA. Immobilized GW9662 (HY-P16578) at 20 μg/mL (100 μ L/well) on the plate can bind Biotinylated Human PPAR gamma. The ED50 for this effect is 1.685 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P37231-1 (D238-D503)

  • Gene ID
    5468  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PPAR gamma (D238-D503)
      Accession # P37231-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferato

  • AA Sequence

    DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

  • Molecular Weight

    Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Changying Yu, et al.Binding analyses between Human PPARgamma-LBD and ligands. Eur J Biochem. 2004 Jan;271(2):386-97 [Content Brief]

[2]. Jun Young Jang, et al. Structural Basis for the Enhanced Anti-Diabetic Efficacy of Lobeglitazone on PPARγ. Sci Rep. 2018 Jan 8;8(1):31. [Content Brief]

[3]. Ye J, et al., Natural flavonoid glycosides Chrysosplenosides I & A rejuvenate intestinal stem cell aging via activation of PPARγ signaling. Life Med. 2024 Jun 28;3(3):lnae025. [Content Brief]

[4]. Ma Y, et al., 18:0 Lyso PC, a natural product with potential PPAR-γ agonistic activity, plays hypoglycemic effect with lower liver toxicity and cardiotoxicity in db/db mice. Biochem Biophys Res Commun. 2021 Nov 19;579:168-174. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Cell Rep Med. 2025 Sep 26:102373. [Abstract]

    Customer Validation
     The surface plasmon resonance (SPR) analysis of UDCA (200, 400, 600, 800, and 1,000 μM) binding to the recombinant human PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999). The SPR analysis was performed using the PlexArray HT System and 3D Dextran sensor chip. The recombinant human PPARγ protein (PPAR gamma Protein, Human (His)) was immobilized on the chip surface and activated with 10 mM NiSO4. The results showed that the UDCA bound directly to the PPARγ protein with an equilibrium dissociation constant of 1.82 × 10 −8 M, exhibiting a strong binding affinity.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Customer Validation
     Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Ecotoxicol Environ Saf. 2025 Nov 15:307:119433. [Abstract]

    Customer Validation
     In vitro, the interactions between recombinant PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999, 100 μg/mL, immobilized on activated CM5 chip at 10 μL/min for 420 s) and four chemicals that induce pulmonary fibrosis were analyzed using surface plasmon resonance (SPR) under varying dose-time gradients. The results showed that the KD for PPARγ and amiodarone was 25.77 µM, whereas that of bleomycin was 317.2 nM, indicating concentration-dependent binding despite an observed negative response after subtraction. Busulfan exhibited a KD of 2.311 µM, and cisplatin displayed a KD of 878.9 nM, confirming their dose-dependent binding.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Life Med. 2024 Jun 28;3(3):lnae025. [Abstract]

    Customer Validation
     Real-time kinetic binding sensorgrams and equilibrium binding signals of CA1 (25–400 µM) and CA2 (2.5–40 µM) were shown. Response (nm) indicates the optical thickness on the NTA biosensor layer. Tresults confirmed that CA1 and CA2 can interact directly and reversibly with PPARγ (PPAR gamma Protein, Human (His), HY-P7999, 50 mg/mL), with dissociation constants (KD) of 75.33 μM and 32.36 μM, respectively. This binding exhibits prominent concentration dependence, and the optical thickness (nm) of the sensing layer increases gradually with the rise in compound concentration.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: FEBS J. 2024 Oct;291(20):4581-4601. [Abstract]

    Customer Validation
     The binding of GDH1 to PPARγ (PPAR gamma Protein, Human (His), HY-P7999) was measured using BIAcore system. The KD value of GDH1 with PPARγ was 4.0×10−10 M, which suggested a strong binding of GDH1 to PPARγ.

  • 1/16

    PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2023 Dec:121:155116. [Abstract]

    Customer Validation
     SPR assays for the interaction between astragaloside IV and PPARγ (PPAR alpha Protein, Human (His), HY-P7996).

  • PPAR gamma Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • Experimental Validation Results for PPAR gamma Protein, Human (His)
  • PPAR gamma Protein, Human (His) Product Image

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Cell Rep Med. 2025 Sep 26:102373. [Abstract]

    The surface plasmon resonance (SPR) analysis of UDCA (200, 400, 600, 800, and 1,000 μM) binding to the recombinant human PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999). The SPR analysis was performed using the PlexArray HT System and 3D Dextran sensor chip. The recombinant human PPARγ protein (PPAR gamma Protein, Human (His)) was immobilized on the chip surface and activated with 10 mM NiSO4. The results showed that the UDCA bound directly to the PPARγ protein with an equilibrium dissociation constant of 1.82 × 10 −8 M, exhibiting a strong binding affinity.

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Ecotoxicol Environ Saf. 2025 Nov 15:307:119433. [Abstract]

    In vitro, the interactions between recombinant PPARγ protein (PPAR gamma Protein, Human (His), HY-P7999, 100 μg/mL, immobilized on activated CM5 chip at 10 μL/min for 420 s) and four chemicals that induce pulmonary fibrosis were analyzed using surface plasmon resonance (SPR) under varying dose-time gradients. The results showed that the KD for PPARγ and amiodarone was 25.77 µM, whereas that of bleomycin was 317.2 nM, indicating concentration-dependent binding despite an observed negative response after subtraction. Busulfan exhibited a KD of 2.311 µM, and cisplatin displayed a KD of 878.9 nM, confirming their dose-dependent binding.

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Life Med. 2024 Jun 28;3(3):lnae025. [Abstract]

    Real-time kinetic binding sensorgrams and equilibrium binding signals of CA1 (25–400 µM) and CA2 (2.5–40 µM) were shown. Response (nm) indicates the optical thickness on the NTA biosensor layer. Tresults confirmed that CA1 and CA2 can interact directly and reversibly with PPARγ (PPAR gamma Protein, Human (His), HY-P7999, 50 mg/mL), with dissociation constants (KD) of 75.33 μM and 32.36 μM, respectively. This binding exhibits prominent concentration dependence, and the optical thickness (nm) of the sensing layer increases gradually with the rise in compound concentration.

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: FEBS J. 2024 Oct;291(20):4581-4601. [Abstract]

    The binding of GDH1 to PPARγ (PPAR gamma Protein, Human (His), HY-P7999) was measured using BIAcore system. The KD value of GDH1 with PPARγ was 4.0×10−10 M, which suggested a strong binding of GDH1 to PPARγ.

  • PPAR gamma Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2023 Dec:121:155116. [Abstract]

    SPR assays for the interaction between astragaloside IV and PPARγ (PPAR alpha Protein, Human (His), HY-P7996).