Copy Link Print Information

PPAR alpha Protein, Human (His)

2 Cited Publications
Kundenbewertung

Based on 2 publication(s) in Google Scholar

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Human
  • Source: E. coli
  • Speicherung:
    Stored at 4°C for 6 months from date of receipt. Recommend aliquoting the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • PPAR alpha Protein, Human (His) Product Image
Größe
Preis
Verfügbarkeit
Menge
Amount: USD 0.00
Please select quantity
or
or

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Finden Sie Ihren Händler vor Ort Your local distributor: Hycultec GmbHHycultec
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Verweise
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biologische Aktivität

Beschreibung

PPAR alpha Protein, human (His), a member of the nuclear receptor family, is a transcription factor that regulates the expression of genes related to lipid metabolism in a ligand-dependent manner.

Background

Peroxisome proliferator-activated receptors (PPARs) are ligand-dependent transcription factors that belong to the nuclear receptor superfamily comprising 48 members in human. PPARs include three subtypes, PPARα, PPARγ, and PPARδ. PPARα is involved in lipid homeostasis by regulating the transcription of sets of genes related to lipid metabolism and thereby reducing blood triglyceride levels. PPARα has attracted attention as a target for hypolipidemic drugs[1].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q07869-1 (D202-Y468)

  • Gene ID
    5465  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PPAR alpha (D202-Y468)
      Accession # Q07869-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPARA, PPAR-α

  • AA Sequence

    DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Reinheit

    ≥ 90%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for PPAR alpha Protein, Human (His)
      ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 2 M Urea.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at 4°C for 6 months from date of receipt. Recommend aliquoting the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.

Versand

Shipping with dry ice.

Verweise

[1]. Takuji Oyama, et al. Crystal Structures of the Human Peroxisome Proliferator-Activated Receptor (PPAR)α Ligand-Binding Domain in Complexes with a Series of Phenylpropanoic Acid Derivatives Generated by a Ligand-Exchange Soaking Method. Biol Pharm Bull. 2021;44(9):1202-1209. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung) Konzentration (Stammlösung)
×
Volumen (Stammlösung) Volumen (Stammlösung)
=
Konzentration (Ziellösung) Konzentration (Ziellösung)
×
Volumen (Ziellösung) Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 90%, as determined by reducing SDS-PAGE.
Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    PPAR alpha Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Customer Validation
     Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.

  • PPAR alpha Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • Experimental Validation Results for PPAR alpha Protein, Human (His)
  • PPAR alpha Protein, Human (His) Product Image

  • PPAR alpha Protein, Human (His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Nov:147:157213. [Abstract]

    Surface plasmon resonance (SPR) results of QCT and PPARA (PPAR alpha Protein, Human (His), HY-P7996, 50 μg/mL)/PPARG(PPAR gamma Protein, Human (His), HY-P7999, 10 μg/mL) proteins. The results showed that the corresponding dissociation constant (KKD) of QCT binding to PPARA was 7.10 μM, and that of QCT binding to PPARG was 12.24 μM, confirming the binding interaction between QCT and PPARA/PPARG.