PPARD Protein, Human (His)
Based on 1 Customer Validation
PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.
Background
PPARD protein, a ligand-activated transcription factor, stands as a crucial mediator of energy metabolism within adipose tissues. Functioning as a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, with a preference for polyunsaturated fatty acids such as gamma-linoleic acid and eicosapentaenoic acid. Upon ligand activation, the receptor engages with promoter elements of target genes, regulating the peroxisomal beta-oxidation pathway of fatty acids and serving as a transcription activator for the acyl-CoA oxidase gene. Additionally, it plays a role in decreasing the expression of NPC1L1 upon ligand activation. PPARD forms a heterodimer with the retinoid X receptor and interacts with CRY1 and CRY2 in a ligand-dependent manner via its NR LBD domain.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q03181-1 (Q171-Y441)
-
Gene ID5467
-
Molecular Construction
-
N-term
-
6*His
-
PPARD (Q171-Y441)
Accession # Q03181-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PPARD; Nuclear Hormone Receptor 1; Peroxisome Proliferator Activated Receptor Delta; PPAR-Delta; NR1C2; PPAR-Beta; PPARB; NUCI; NUC1; Peroxisome Proliferator-Activated Nuclear Receptor Beta/Delta Variant 2; Peroxisome Proliferator-Activated Receptor Delta
-
AA Sequence
QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
-
Predicted Molecular Mass
37.9 kDa
-
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)