PPAR gamma Protein, Human
Based on 1 Customer Validation
The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with tag free.
PPAR gamma Protein, a nuclear receptor, binds to peroxisome proliferators such as hypolipidemic drugs and fatty acids. Upon ligand activation, the nuclear receptor interacts with specific PPAR response elements (PPRE) on DNA, modulating the transcription of target genes like acyl-CoA oxidase and thereby controlling the peroxisomal beta-oxidation pathway of fatty acids. It plays a pivotal role as a key regulator in adipocyte differentiation and glucose homeostasis. Additionally, PPAR gamma acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses. In the context of cardiovascular circadian rhythms, it regulates the transcription of BMAL1 in blood vessels. Furthermore, in response to microbial infection, particularly treatment with M.tuberculosis or its lipoprotein LpqH, PPAR gamma modulates phosphorylation of MAPK p38 and IL-6 production, suggesting its involvement in immune responses during microbial challenges.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P37231-1 (P234-Y505)
-
Gene ID5468
-
Molecular Construction
-
N-term
-
PPAR gamma (P234-Y505)
Accession # P37231-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferato
-
AA Sequence
PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
-
Predicted Molecular Mass
31.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
