Copy Link Print Information

PSMG3 Protein, Human

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human is the recombinant human-derived PSMG3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • PSMG3 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human is the recombinant human-derived PSMG3 protein, expressed by E. coli , with tag free.

Background

PSMG3 (Proteasome assembly chaperone 3) is a chaperone protein crucial for the assembly of the 20S proteasome, an essential component of the cellular protein degradation machinery. PSMG3 may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Existing as a homodimer, PSMG3 interacts with PSMG4 and directly engages with both alpha and beta subunits of the 20S proteasome. Notably, it dissociates before the formation of half-proteasomes, likely occurring upon the recruitment of POMP. This highlights PSMG3's role in facilitating the precise assembly of the 20S proteasome, a critical process for maintaining cellular homeostasis through effective protein degradation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9BT73 (M1-W122)

  • Gene ID
    84262
  • Molecular Construction
    • N-term
    • PSMG3 (M1-W122)
      Accession # Q9BT73
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PSMG3; Proteasome assembly chaperone 3; PAC-3; hPAC3

  • AA Sequence

    MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PSMG3 Protein, Human Product Image
    1/16
  • PSMG3 Protein, Human Product Image