1. Recombinant Proteins
  2. Others
  3. PSMG3 Protein, Human

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human is the recombinant human-derived PSMG3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PSMG3 protein acts as a chaperone and actively promotes the assembly of the 20S proteasome. It involves potential cooperation with the PSMG1-PSMG2 heterodimer to ensure precise assembly of the proteasome. PSMG3 Protein, Human is the recombinant human-derived PSMG3 protein, expressed by E. coli , with tag free.

Background

PSMG3 (Proteasome assembly chaperone 3) is a chaperone protein crucial for the assembly of the 20S proteasome, an essential component of the cellular protein degradation machinery. PSMG3 may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes. Existing as a homodimer, PSMG3 interacts with PSMG4 and directly engages with both alpha and beta subunits of the 20S proteasome. Notably, it dissociates before the formation of half-proteasomes, likely occurring upon the recruitment of POMP. This highlights PSMG3's role in facilitating the precise assembly of the 20S proteasome, a critical process for maintaining cellular homeostasis through effective protein degradation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9BT73 (M1-W122)

Gene ID

84262

Molecular Construction
N-term
PSMG3 (M1-W122)
Accession # Q9BT73
C-term
Protein Length

Full Length

Synonyms
PSMG3; Proteasome assembly chaperone 3; PAC-3; hPAC3
AA Sequence

MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PSMG3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PSMG3 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSMG3 Protein, Human
Cat. No.:
HY-P701388
Quantity:
MCE Japan Authorized Agent: