1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PSMP Protein, Human (HEK293, Fc)

PSMP Protein acts as a ligand for CCR2, inducing chemotaxis and calcium mobilization. It attracts monocytes and lymphocytes, not neutrophils. It contributes to neuropathic pain and enhances synaptic transmission in dopamine neurons. PSMP Protein exists as a monomer or homodimer, binding to endothelial cells via proteoglycans. It interacts with TNFAIP6. PSMP Protein, Human (HEK293, Fc) is the recombinant human-derived PSMP protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSMP Protein acts as a ligand for CCR2, inducing chemotaxis and calcium mobilization. It attracts monocytes and lymphocytes, not neutrophils. It contributes to neuropathic pain and enhances synaptic transmission in dopamine neurons. PSMP Protein exists as a monomer or homodimer, binding to endothelial cells via proteoglycans. It interacts with TNFAIP6. PSMP Protein, Human (HEK293, Fc) is the recombinant human-derived PSMP protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PSMP Protein acts as a ligand for C-C chemokine receptor CCR2, leading to the activation and binding of CCR2 and subsequently inducing a strong chemotactic response and mobilization of intracellular calcium ions. It displays chemotactic activity specifically for monocytes and lymphocytes, but not for neutrophils. Additionally, PSMP Protein plays a crucial role in mediating neuropathic pain resulting from peripheral nerve injury. It enhances NMDA-mediated synaptic transmission in dopamine D1 and D2 receptor-containing neurons, potentially through MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. PSMP Protein exists as a monomer or homodimer, with its presence on endothelial cells facilitated by glycosaminoglycan (GAG) side chains of proteoglycans. Furthermore, it interacts with TNFAIP6 through its Link domain.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q1L6U9 (K37-S139)

Gene ID
Molecular Construction
N-term
PSMP (K37-S139)
Accession # Q1L6U9
hFc
C-term
Protein Length

Partial

Synonyms
Msmp; Psmp
AA Sequence

KCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

Predicted Molecular Mass
37.9 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSMP Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PSMP Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSMP Protein, Human (HEK293, Fc)
Cat. No.:
HY-P78027
Quantity:
MCE Japan Authorized Agent: