Copy Link Print Information

PSMP Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

PSMP Protein acts as a ligand for CCR2, inducing chemotaxis and calcium mobilization. It attracts monocytes and lymphocytes, not neutrophils. It contributes to neuropathic pain and enhances synaptic transmission in dopamine neurons. PSMP Protein exists as a monomer or homodimer, binding to endothelial cells via proteoglycans. It interacts with TNFAIP6. PSMP Protein, Human (HEK293, Fc) is the recombinant human-derived PSMP protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • PSMP Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PSMP Protein acts as a ligand for CCR2, inducing chemotaxis and calcium mobilization. It attracts monocytes and lymphocytes, not neutrophils. It contributes to neuropathic pain and enhances synaptic transmission in dopamine neurons. PSMP Protein exists as a monomer or homodimer, binding to endothelial cells via proteoglycans. It interacts with TNFAIP6. PSMP Protein, Human (HEK293, Fc) is the recombinant human-derived PSMP protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PSMP Protein acts as a ligand for C-C chemokine receptor CCR2, leading to the activation and binding of CCR2 and subsequently inducing a strong chemotactic response and mobilization of intracellular calcium ions. It displays chemotactic activity specifically for monocytes and lymphocytes, but not for neutrophils. Additionally, PSMP Protein plays a crucial role in mediating neuropathic pain resulting from peripheral nerve injury. It enhances NMDA-mediated synaptic transmission in dopamine D1 and D2 receptor-containing neurons, potentially through MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. PSMP Protein exists as a monomer or homodimer, with its presence on endothelial cells facilitated by glycosaminoglycan (GAG) side chains of proteoglycans. Furthermore, it interacts with TNFAIP6 through its Link domain.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q1L6U9 (K37-S139)

  • Gene ID
    692094  [NCBI]
  • Molecular Construction
    • N-term
    • PSMP (K37-S139)
      Accession # Q1L6U9
    • hFc
    • C-term
  • Protein Length

    Full Length of Prostate-associated microseminoprotein Chain

  • Synonyms

    MSMP; PC-3; Microseminoprotein, Prostate Associated; PC3 Prostate Cancer Cell-Secreted Microprotein; PSMP; PC3-Secreted Microprotein; Prostate-Associated Microseminoprotein

  • AA Sequence

    KCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

  • Predicted Molecular Mass

    37.9 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PSMP Protein, Human (HEK293, Fc) Product Image
    1/16
  • PSMP Protein, Human (HEK293, Fc) Product Image