PTP4A1 Protein, Human (His)
Based on 1 Customer Validation
The PTP4A1 protein is an active tyrosine phosphatase that not only stimulates the G1 to S phase progression of mitosis but also plays a crucial role in the development and maintenance of differentiated epithelial tissues. Its multifunctional contribution extends to cell differentiation, profoundly affecting cell behavior by enhancing proliferation, motility, and invasive activity. PTP4A1 Protein, Human (His) is the recombinant human-derived PTP4A1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PTP4A1 protein is an active tyrosine phosphatase that not only stimulates the G1 to S phase progression of mitosis but also plays a crucial role in the development and maintenance of differentiated epithelial tissues. Its multifunctional contribution extends to cell differentiation, profoundly affecting cell behavior by enhancing proliferation, motility, and invasive activity. PTP4A1 Protein, Human (His) is the recombinant human-derived PTP4A1 protein, expressed by E. coli , with N-His labeled tag.
Background
PTP4A1 protein, a dynamic protein tyrosine phosphatase, emerges as a key regulator that stimulates the progression from G1 into S phase during mitosis. Beyond its mitotic role, PTP4A1 is implicated in the development and maintenance of differentiating epithelial tissues, underscoring its versatile contributions to cellular differentiation. Notably, PTP4A1 exhibits a profound impact on cellular behavior, enhancing cell proliferation, motility, and invasive activity. In the context of cancer, PTP4A1 takes on a pivotal role, promoting metastasis. Its multifaceted functions highlight the crucial involvement of PTP4A1 in orchestrating diverse cellular processes, with implications for both normal tissue development and pathological conditions associated with cancer progression and metastasis.
Verified Bioactivity
Measured by its ability to cleave a substrate. p-Nitrophenvl phosphate (pNPP). The specific activity is > 0.5 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
Q93096 (M1-C170)
-
Molecular Construction
-
N-term
-
8*His
-
PTP4A1 (M1-C170)
Accession # Q93096 -
C-term
-
-
Protein Length
Full Length of Protein tyrosine phosphatase type IVA 1 Chain
-
Synonyms
PTP4A1; Phosphatase Of Regenerating Liver 1; Protein Tyrosine Phosphatase 4A1; Protein Tyrosine Phosphatase Type IVA Protein 1; PTPCAAX1; Protein-Tyrosine Phosphatase 4a1; PRL-1; Protein-Tyrosine-Phosphatase; PRL1; PVT1/PTP4A1 Fusion; Protein-Tyrosine Pho
-
AA Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNC
-
Predicted Molecular Mass
20.6 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22μm filtered solution of 20mM Tris, 250mM NaCl, 1mM DTT, 20% Glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
