Copy Link Print Information

PTPRZ1 Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • PTPRZ1 Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

Background

PTPRZ1 protein, a pivotal protein tyrosine phosphatase, serves as a negative regulator of oligodendrocyte precursor proliferation within the embryonic spinal cord. Its essential role extends to the normal differentiation of precursor cells, guiding their transformation into mature, fully myelinating oligodendrocytes. Additionally, PTPRZ1 may act as a protective factor against apoptosis in oligodendrocytes. Beyond its involvement in oligodendrocyte function, PTPRZ1 is implicated in the establishment of contextual memory, potentially through the dephosphorylation of proteins within crucial signaling cascades. This multifaceted role underscores the significance of PTPRZ1 in the intricate processes of oligodendrocyte development and neural signaling, shedding light on its potential contributions to both cellular differentiation and memory formation.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-His
  • Accession

    P23471-1 (I36-Y300)

  • Gene ID
    5803  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • PTPRZ1 (I36-Y300)
      Accession # P23471-1
    • C-term
  • Protein Length

    Full Length of Alpha-carbonic anhydrase Domain

  • Synonyms

    PTPRZ1; Protein Tyrosine Phosphatase, Receptor-Type, Zeta Polypeptide 1; Prev. PTPRZ; Receptor-Type Tyrosine Phosphatase Beta/Zeta; Prev. PTPZ; Protein-Tyrosine-Phosphatase; Receptor-Type Tyrosine-Protein Phosphatase Zeta; R-PTP-Zeta; Phosphacan; HPTPzeta; PTP18; PTP-ZETA; RPTPB; RPTPbeta; Protein Tyrosine Phosphatase, Receptor-Type, Z Polypeptide 1; PTPRZ2; Protein-Tyrosine Phosphatase Receptor Type Z Polypeptide 2; HTPZP2; R-PTP-Zeta-2; HPTPZ; Protein Tyrosine Phosphatase Receptor Type Z1; Protein-Tyrosine Phosphatase Receptor Type Z Polypeptide 1

  • AA Sequence

    IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

  • Predicted Molecular Mass

    32.1 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PTPRZ1 Protein, Human (P.pastoris, His) Product Image
    1/16
  • PTPRZ1 Protein, Human (P.pastoris, His) Product Image