Copy Link Print Information

RCN1 Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • RCN1 Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

Background

RCN1 Protein emerges as a potential regulator, suggesting its role in modulating calcium-dependent activities within the endoplasmic reticulum (ER) lumen or the post-ER compartment. The specific mechanisms through which RCN1 exerts its regulatory influence on calcium-dependent processes remain to be fully elucidated, prompting further investigation into its functional significance in these cellular compartments. The proposed role of RCN1 in calcium regulation hints at its potential involvement in diverse cellular activities associated with calcium signaling and homeostasis. Comprehensive studies are essential to unravel the precise molecular pathways through which RCN1 modulates calcium-dependent activities and to understand its broader implications in cellular processes.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-His
  • Accession

    Q15293-1 (31P-L331)

  • Gene ID
    5954  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • RCN1 (31P-331L)
      Accession # Q15293
    • C-term
  • Protein Length

    Full Length of Reticulocalbin-1 Chain

  • Synonyms

    RCN1; Reticulocalbin 1, EF-Hand Calcium Binding Domain; Prev. RCN; FLJ37041; Reticulocalbin-1; Epididymis Secretory Protein Li 84; PIG20; HEL-S-84; Rcal; Reticulocalbin 1; Proliferation-Inducing Gene 20

  • AA Sequence

    PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

  • Predicted Molecular Mass

    37.7 kDa

  • Molecular Weight

    Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • RCN1 Protein, Human (P.pastoris, His) Product Image
    1/16
  • RCN1 Protein, Human (P.pastoris, His) Product Image