RCVRN Protein, Human (P.pastoris, His)
The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (P.pastoris, His) is the recombinant human-derived RCVRN protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RCVRN protein is a calcium sensor that regulates phototransduction in cone and rod photoreceptors, enhancing the light sensitivity of cone photoreceptors in dark conditions. Under low light, it prolongs RHO/rhodopsin activation in rod photoreceptor cells by inhibiting GRK1-mediated phosphorylation. RCVRN Protein, Human (P.pastoris, His) is the recombinant human-derived RCVRN protein, expressed by P. pastoris , with N-His labeled tag.
Background
RCVRN protein serves as a calcium sensor, intricately involved in regulating phototransduction in both cone and rod photoreceptor cells. It plays a crucial role in modulating the light sensitivity of cone photoreceptors, particularly in dark and dim conditions. In response to elevated Ca(2+) levels induced by low light, RCVRN extends the activation of RHO/rhodopsin in rod photoreceptor cells by binding to and inhibiting GRK1-mediated phosphorylation of RHO/rhodopsin. This protein contributes to scotopic vision, enhancing vision in low-light conditions by facilitating signal transfer between rod photoreceptors and rod bipolar cells. Moreover, RCVRN improves rod photoreceptor sensitivity in dim light, mediating responses that aid in the detection of changes and motion in bright light. Existing as a homodimer, RCVRN undergoes disulfide-linked dimerization, a process triggered by prolonged intense illumination. Additionally, RCVRN may form a complex with RHO and GRK1 in a Ca(2+)-dependent manner, preventing the interaction between GRK1 and RHO.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
P35243 (G2-A200)
-
Molecular Construction
-
N-term
-
His
-
RCVRN (G2-A200)
Accession # P35243 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RCVRN; Cancer-Associated Retinopathy Protein; Prev. RCV1; Protein CAR; Recoverin; Cancer Associated Retinopathy Antigen
-
AA Sequence
GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
-
Predicted Molecular Mass
25 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
