REG-3 beta/REG3B Protein, Mouse

REG-3 beta/REG3B Protein, a bactericidal C-type lectin, combats intestinal Gram-positive and Gram-negative bacteria, except S.typhimurium. It inhibits S.enteritidis translocation, safeguarding against infection. Beyond antibacterial action, REG-3 beta functions hormonally, activating EXTL3 receptor for cell-specific signaling. In the pancreas, it notably stimulates cell proliferation. REG-3 beta/REG3B Protein, Mouse is the recombinant mouse-derived REG-3 beta/REG3B protein, expressed by E. coli , with no tag.

REG-3 beta/REG3B, a bactericidal C-type lectin, exhibits antimicrobial properties against various intestinal Gram-positive and Gram-negative bacteria, with the exception of S.typhimurium. Its potential role in protecting against S.enteritidis infection involves inhibiting the translocation of the pathogen from the gut lumen into intestinal and extraintestinal tissues. Beyond its antibacterial function, REG-3 beta acts as a hormone in response to diverse stimuli. When secreted by different cell types, it activates its receptor EXTL3, initiating cell-specific signaling pathways. Notably, in the pancreas, REG-3 beta has the ability to stimulate cell proliferation.

Mouse

E. coli

Tag Free

P35230 (I38-G175)

18489

Full Length of Mature Protein

ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.