RET Protein, Human (Active, V804L, sf9, His-GST, Avi)
RET protein is a receptor tyrosine protein kinase that plays a key role in cell proliferation, neuronal navigation, and differentiation upon binding to glial cell-derived neurotrophic factor family ligands. It regulates the delicate balance between cell death and survival, influences positional information, and is critical for intestinal organogenesis, enteric nervous system development, renal organogenesis, and Peyer's patch formation. RET, Human (Active, V804L, sf9, His-GST, Avi) is the recombinant human-derived RET protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RET protein is a receptor tyrosine protein kinase that plays a key role in cell proliferation, neuronal navigation, and differentiation upon binding to glial cell-derived neurotrophic factor family ligands. It regulates the delicate balance between cell death and survival, influences positional information, and is critical for intestinal organogenesis, enteric nervous system development, renal organogenesis, and Peyer's patch formation. RET, Human (Active, V804L, sf9, His-GST, Avi) is the recombinant human-derived RET protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
The RET protein, a receptor tyrosine-protein kinase, plays a crucial role in diverse cellular processes such as cell proliferation, neuronal navigation, migration, and differentiation upon binding with glial cell-derived neurotrophic factor family ligands. It phosphorylates PTK2/FAK1 and regulates the delicate balance between cell death and survival, as well as positional information. Essential for the molecular coordination during intestine organogenesis, RET is involved in the development of the enteric nervous system, renal organogenesis, and promotes the formation of Peyer's patch-like structures in the gut-associated lymphoid tissue. Furthermore, RET modulates cell adhesion, mediated by caspase cleavage in sympathetic neurons, and facilitates cell migration in an integrin-dependent manner. Operating as a dependence receptor, it triggers apoptosis in the absence of the ligand GDNF in somatotrophs but promotes survival and downregulates growth hormone production in its presence. RET is a key mediator in various diseases, particularly neuroendocrine cancers characterized by aberrant integrins-regulated cell migration. Additionally, it mediates GDF15-induced cell signaling in the brainstem through interaction with GFRAL, resulting in the inhibition of food intake and activation of MAPK- and AKT-signaling pathways. Notably, isoform 1 in complex with GFRAL induces higher activation of the MAPK-signaling pathway compared to isoform 2 in the same complex.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P07949-1 (H658-S1114, V804L)
-
Gene ID5979
-
Molecular Construction
-
N-term
-
His-GST
-
(H658-S1114, V804L)
Accession # P07949-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
RET; Cadherin Family Member 12; Prev. HSCR1; RET51; Prev. MEN2A; Ret Proto-Oncogene (Multiple Endocrine Neoplasia And Medullary Thyroid Carcinoma 1, Hirschsprung Disease); Prev. MEN2B; Multiple Endocrine Neoplasia And Medullary Thyroid Carcinoma 1; Prev.
-
AA Sequence
HCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLILEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)