RET Protein, Human (Active, V804L, sf9, His-GST, Avi)

RET protein is a receptor tyrosine protein kinase that plays a key role in cell proliferation, neuronal navigation, and differentiation upon binding to glial cell-derived neurotrophic factor family ligands. It regulates the delicate balance between cell death and survival, influences positional information, and is critical for intestinal organogenesis, enteric nervous system development, renal organogenesis, and Peyer's patch formation. RET, Human (Active, V804L, sf9, His-GST, Avi) is the recombinant human-derived RET protein, expressed by sf9 insect cells, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

RET protein is a receptor tyrosine protein kinase that plays a key role in cell proliferation, neuronal navigation, and differentiation upon binding to glial cell-derived neurotrophic factor family ligands. It regulates the delicate balance between cell death and survival, influences positional information, and is critical for intestinal organogenesis, enteric nervous system development, renal organogenesis, and Peyer's patch formation. RET, Human (Active, V804L, sf9, His-GST, Avi) is the recombinant human-derived RET protein, expressed by sf9 insect cells, with N-Avi labeled tag.

Background

The RET protein, a receptor tyrosine-protein kinase, plays a crucial role in diverse cellular processes such as cell proliferation, neuronal navigation, migration, and differentiation upon binding with glial cell-derived neurotrophic factor family ligands. It phosphorylates PTK2/FAK1 and regulates the delicate balance between cell death and survival, as well as positional information. Essential for the molecular coordination during intestine organogenesis, RET is involved in the development of the enteric nervous system, renal organogenesis, and promotes the formation of Peyer's patch-like structures in the gut-associated lymphoid tissue. Furthermore, RET modulates cell adhesion, mediated by caspase cleavage in sympathetic neurons, and facilitates cell migration in an integrin-dependent manner. Operating as a dependence receptor, it triggers apoptosis in the absence of the ligand GDNF in somatotrophs but promotes survival and downregulates growth hormone production in its presence. RET is a key mediator in various diseases, particularly neuroendocrine cancers characterized by aberrant integrins-regulated cell migration. Additionally, it mediates GDF15-induced cell signaling in the brainstem through interaction with GFRAL, resulting in the inhibition of food intake and activation of MAPK- and AKT-signaling pathways. Notably, isoform 1 in complex with GFRAL induces higher activation of the MAPK-signaling pathway compared to isoform 2 in the same complex.

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • (H658-S1114, V804L)
      Accession # P07949-1
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    RET; Cadherin Family Member 12; Prev. HSCR1; RET51; Prev. MEN2A; Ret Proto-Oncogene (Multiple Endocrine Neoplasia And Medullary Thyroid Carcinoma 1, Hirschsprung Disease); Prev. MEN2B; Multiple Endocrine Neoplasia And Medullary Thyroid Carcinoma 1; Prev.

  • AA Sequence

    HCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLILEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipped with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00