Rev Protein, HIV-1 group M subtype C (GST)

Rev Protein, HIV-1 group M subtype C (GST) is the recombinant virus-derived Rev protein, expressed by E. coli, with N-GST tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Rev Protein, HIV-1 group M subtype C (GST) is the recombinant virus-derived Rev protein, expressed by E. coli, with N-GST tag.

Background

Rev is a viral protein that escorts unspliced or incompletely spliced viral pre-mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, which is absent in fully spliced viral mRNAs (early transcripts). This function is essential because most viral proteins are translated from unspliced or partially spliced pre-mRNAs that cannot exit the nucleus via the pathway used by fully processed cellular mRNAs. Rev itself is translated from a fully spliced mRNA that readily exits the nucleus. Rev's nuclear localization signal (NLS) binds directly to KPNB1/Importin beta-1 without prior binding to KPNA1/Importin alpha-1. KPNB1 binds to the GDP-bound form of RAN (Ran-GDP) and targets Rev to the nucleus. In the nucleus, the conversion from Ran-GDP to Ran-GTP dissociates Rev from KPNB1, allowing Rev to bind to the RRE in viral pre-mRNAs. Rev multimerizes on the RRE through cooperative assembly, exposing its nuclear export signal (NES) on the surface. Rev can then form a complex with XPO1/CRM1 and Ran-GTP, facilitating nuclear export of the complex. Conversion from Ran-GTP to Ran-GDP mediates dissociation of the Rev/RRE/XPO1/RAN complex, enabling Rev to return to the nucleus for subsequent export cycles. Besides KPNB1, Rev also appears to interact with TNPO1/Transportin-1, RANBP5/IPO5, and IPO7/RANBP7 for nuclear import. The nucleoporin-like HRB/RIP is an essential cofactor that likely interacts indirectly with Rev to release HIV RNAs from the perinuclear region to the cytoplasm.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-GST
  • Accession
  • Molecular Construction
    • N-term
    • GST
    • (M1-P107)
      Accession # Q75006
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    rev; Protein Rev; ART/TRS; Anti-repression transactivator; Regulator of expression of viral proteins

  • AA Sequence

    MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP

  • Predicted Molecular Mass

    38.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00