RGS17 Protein, Human (GST)
RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.
Background
The RGS17 protein plays a pivotal role in the regulation of G protein-coupled receptor signaling cascades, including those mediated by muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Its regulatory function involves inhibiting signal transduction by enhancing the GTPase activity of G protein alpha subunits, thereby promoting their transition into the inactive GDP-bound form. RGS17 exhibits selective binding to GNAZ and GNAI2 subunits, accelerating their GTPase activity and modulating their signaling activities. Additionally, RGS17 negatively regulates mu-opioid receptor-mediated activation of G-proteins. The protein interacts with GNAI1 and GNAQ and forms complexes with mu-opioid receptors and Gαz/i2 subunits, contributing to mu-opioid receptor desensitization. Further molecular interactions include binding to OPRM1 and interacting with HINT1, underscoring the intricate regulatory network in which RGS17 participates to modulate diverse G protein-dependent signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9UGC6 (M1-S210)
-
Molecular Construction
-
N-term
-
GST
-
RGS17 (M1-S210)
Accession # Q9UGC6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RGS17; RGS-17; Regulator Of G Protein Signaling 17; Regulator Of G-Protein Signalling 17; RGSZ2; HRGS17; Regulator Of G-Protein Signaling 17
-
AA Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
-
Predicted Molecular Mass
51.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
