Copy Link Print Information

RNASET2 Protein, Human (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (sf9, His) is the recombinant human-derived RNASET2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for RNASET2 Protein, Human (sf9, His)
  • RNASET2 Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (sf9, His) is the recombinant human-derived RNASET2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The RNASET2 protein functions as a ribonuclease, playing a vital role in the innate immune response by recognizing and degrading RNAs from microbial pathogens, subsequently sensed by TLR8. This ribonuclease exhibits a preferential cleavage of single-stranded RNA molecules between purine and uridine residues, a process crucial for the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. These RNase T2 degradation products, in turn, actively promote the RNA-dependent activation of TLR8. Beyond its role in immune response, RNASET2 also plays a key role in the degradation of mitochondrial RNA and the processing of non-coding RNA imported from the cytosol into mitochondria. Additionally, it participates in the degradation of mitochondrion-associated cytosolic rRNAs, emphasizing its multifaceted involvement in RNA metabolism and immune regulation.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    O00584 (D25-H256)

  • Gene ID
    8635  [NCBI]
  • Molecular Construction
    • N-term
    • RNASET2 (D25-H256)
      Accession # O00584
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RNASET2; BA514O12.3; Ribonuclease T2; Ribonuclease 6; RNASE6PL; FLJ10907

  • AA Sequence

    DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

  • Predicted Molecular Mass

    28.5 kDa

  • Molecular Weight

    Approximately 35-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • RNASET2 Protein, Human (sf9, His) Product Image
    1/16
  • Experimental Validation Results for RNASET2 Protein, Human (sf9, His)
  • RNASET2 Protein, Human (sf9, His) Product Image