1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. RNF135 Protein, Human (His)

The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human (His) is the recombinant human-derived RNF135 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human (His) is the recombinant human-derived RNF135 protein, expressed by E. coli , with N-6*His labeled tag.

Background

RNF135, as an E2-dependent E3 ubiquitin-protein ligase, plays a pivotal role in the innate immune response by serving as a coreceptor for RIGI in the detection of viral RNAs within the cell cytoplasm. Collaborating with the UBE2D3, UBE2N, and UB2V1 E2 ligases, RNF135 orchestrates the 'Lys-63'-linked polyubiquitination of RIGI, which is crucial for the activation of the RIG-I signaling pathway during viral infection. Additionally, through a ubiquitin-independent mechanism, RNF135 facilitates the bridging of RIGI filaments formed on longer viral RNAs, further enhancing RIG-I pathway activation. This dual mechanism, involving both ubiquitin-dependent and -independent processes, suggests a sophisticated regulation of the RIG-I signaling pathway, potentially influenced by the length of the viral RNA. Furthermore, in association with the E2 ligase UBE2N, RNF135 constitutively generates unanchored 'Lys-63'-linked polyubiquitin chains, providing an alternative means to activate the RIG-I signaling pathway and emphasizing the complexity of RNF135's involvement in antiviral immune responses.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q8IUD6 (A2-V432)

Gene ID

84282

Molecular Construction
N-term
6*His
RNF135 (A2-V432)
Accession # Q8IUD6
C-term
Protein Length

Partial

Synonyms
RNF135; E3 ubiquitin-protein ligase RNF135; RIG-I E3 ubiquitin ligase; REUL; RING finger protein 135; RING finger protein leading to RIG-I activation; Riplet; RING-type E3 ubiquitin transferase RNF135
AA Sequence

AGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF135 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF135 Protein, Human (His)
Cat. No.:
HY-P701553
Quantity:
MCE Japan Authorized Agent: