RNF135 Protein, Human (His)
The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human (His) is the recombinant human-derived RNF135 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RNF135 protein acts as an E2-dependent E3 ubiquitin protein ligase and serves as a RIGI coreceptor for viral RNA sensing and activation of antiviral innate immune responses. RNF135 Protein, Human (His) is the recombinant human-derived RNF135 protein, expressed by E. coli , with N-6*His labeled tag.
Background
RNF135, as an E2-dependent E3 ubiquitin-protein ligase, plays a pivotal role in the innate immune response by serving as a coreceptor for RIGI in the detection of viral RNAs within the cell cytoplasm. Collaborating with the UBE2D3, UBE2N, and UB2V1 E2 ligases, RNF135 orchestrates the 'Lys-63'-linked polyubiquitination of RIGI, which is crucial for the activation of the RIG-I signaling pathway during viral infection. Additionally, through a ubiquitin-independent mechanism, RNF135 facilitates the bridging of RIGI filaments formed on longer viral RNAs, further enhancing RIG-I pathway activation. This dual mechanism, involving both ubiquitin-dependent and -independent processes, suggests a sophisticated regulation of the RIG-I signaling pathway, potentially influenced by the length of the viral RNA. Furthermore, in association with the E2 ligase UBE2N, RNF135 constitutively generates unanchored 'Lys-63'-linked polyubiquitin chains, providing an alternative means to activate the RIG-I signaling pathway and emphasizing the complexity of RNF135's involvement in antiviral immune responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8IUD6 (A2-V432)
-
Gene ID84282
-
Molecular Construction
-
N-term
-
6*His
-
RNF135 (A2-V432)
Accession # Q8IUD6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RNF135; RIG-I E3 Ubiquitin Ligase; Ring Finger Protein 135; MGC13061; Riplet; REUL; RING Finger Protein Leading To RIG-I Activation; RING Finger Protein 135; RING-Type E3 Ubiquitin Transferase RNF135; MMFD; E3 Ubiquitin-Protein Ligase RNF135; L13
-
AA Sequence
AGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
