1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. RNF4 Protein, Human (Active, Biotinylated, 71a.a)

RNF4 Protein, Human (Active, Biotinylated, 71a.a)

Cat. No.: HY-P703189
Handling Instructions Technical Support

RNF4 protein is an E3 ubiquitin protein ligase that can uniquely bind and ubiquitinate polyubiquitination chains, mediating "Lys-6", "Lys-11", "Lys-48" and "Lys- 63"-linked polyubiquitination to promote proteasomal degradation. Its multiple substrates, including PML and PEA3, regulate various cellular processes. RNF4 Protein, Human (Active, Biotinylated, 71a.a) is the recombinant human-derived RNF4, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RNF4 protein is an E3 ubiquitin protein ligase that can uniquely bind and ubiquitinate polyubiquitination chains, mediating "Lys-6", "Lys-11", "Lys-48" and "Lys- 63"-linked polyubiquitination to promote proteasomal degradation. Its multiple substrates, including PML and PEA3, regulate various cellular processes. RNF4 Protein, Human (Active, Biotinylated, 71a.a) is the recombinant human-derived RNF4, expressed by E. coli, with tag-free.

Background

RNF4 Protein operates as an E3 ubiquitin-protein ligase with a distinctive ability to bind polysumoylated chains covalently attached to proteins, facilitating the 'Lys-6', 'Lys-11', 'Lys-48', and 'Lys-63'-linked polyubiquitination of its substrates. These substrates are subsequently targeted for proteasomal degradation, contributing to the regulation of various cellular processes. RNF4 plays a role in the degradation of proteins such as PML and the transcriptional activator PEA3. In the context of chromosome dynamics, it influences kinetochore assembly, specifically targeting polysumoylated CENPI for proteasomal degradation and thereby impacting chromosome alignment and spindle assembly. Furthermore, RNF4 is implicated in cellular responses to hypoxia and heat shock, facilitating the degradation of EPAS1 and PARP1, respectively. Additionally, RNF4 may interact with DNA/nucleosomes, suggesting a potential direct involvement in transcriptional regulation, including the enhancement of basal transcription and steroid receptor-mediated transcriptional activation. Notably, it catalyzes the ubiquitination of sumoylated PARP1 in response to PARP1 trapping to chromatin, leading to the removal of PARP1 from chromatin facilitated by VCP/p97.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P78317-1 (G120-I190)

Gene ID

6047

Protein Length

Partial

Conjugation

Biotin

Synonyms
SNURF
AA Sequence

GATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI

Predicted Molecular Mass
8.6 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RNF4 Protein, Human (Active, Biotinylated, 71a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF4 Protein, Human (Active, Biotinylated, 71a.a)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF4 Protein, Human (Active, Biotinylated, 71a.a)
Cat. No.:
HY-P703189
Quantity:
MCE Japan Authorized Agent: