RNF4 Protein, Human (Active, Biotinylated, 71a.a)

RNF4 protein is an E3 ubiquitin protein ligase that can uniquely bind and ubiquitinate polyubiquitination chains, mediating "Lys-6", "Lys-11", "Lys-48" and "Lys- 63"-linked polyubiquitination to promote proteasomal degradation. Its multiple substrates, including PML and PEA3, regulate various cellular processes. RNF4 Protein, Human (Active, Biotinylated, 71a.a) is the recombinant human-derived RNF4, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RNF4 protein is an E3 ubiquitin protein ligase that can uniquely bind and ubiquitinate polyubiquitination chains, mediating "Lys-6", "Lys-11", "Lys-48" and "Lys- 63"-linked polyubiquitination to promote proteasomal degradation. Its multiple substrates, including PML and PEA3, regulate various cellular processes. RNF4 Protein, Human (Active, Biotinylated, 71a.a) is the recombinant human-derived RNF4, expressed by E. coli, with tag-free.

Background

RNF4 Protein operates as an E3 ubiquitin-protein ligase with a distinctive ability to bind polysumoylated chains covalently attached to proteins, facilitating the 'Lys-6', 'Lys-11', 'Lys-48', and 'Lys-63'-linked polyubiquitination of its substrates. These substrates are subsequently targeted for proteasomal degradation, contributing to the regulation of various cellular processes. RNF4 plays a role in the degradation of proteins such as PML and the transcriptional activator PEA3. In the context of chromosome dynamics, it influences kinetochore assembly, specifically targeting polysumoylated CENPI for proteasomal degradation and thereby impacting chromosome alignment and spindle assembly. Furthermore, RNF4 is implicated in cellular responses to hypoxia and heat shock, facilitating the degradation of EPAS1 and PARP1, respectively. Additionally, RNF4 may interact with DNA/nucleosomes, suggesting a potential direct involvement in transcriptional regulation, including the enhancement of basal transcription and steroid receptor-mediated transcriptional activation. Notably, it catalyzes the ubiquitination of sumoylated PARP1 in response to PARP1 trapping to chromatin, leading to the removal of PARP1 from chromatin facilitated by VCP/p97.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Conjugation

    Biotin

  • Synonyms

    RNF4; RING Finger Protein 4; Ring Finger Protein 4; RING-Type E3 Ubiquitin Transferase RNF4; SNURF; Small Nuclear RING Finger Protein; E3 Ubiquitin-Protein Ligase RNF4; Small Nuclear Ring Finger Protein; RES4-26; E3 Ubiquitin Ligase RNF4; SLX5; Protein SN

  • AA Sequence

    GATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI

  • Predicted Molecular Mass

    8.6 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00