ROR1 Protein, Mouse (HEK293, His)
ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo.It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling.Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons.ROR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo.It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling.Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons.ROR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROR1 protein, expressed by HEK293 , with C-His labeled tag.
ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It serves as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, ROR1 plays a crucial role in the inner ear, particularly in facilitating the innervation of auditory hair cells by spiral ganglion neurons.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9Z139 (Q30-Y406)
-
Molecular Construction
-
N-term
-
ROR1 (Q30-Y406)
Accession # Q9Z139 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ROR1; Neurotrophic Tyrosine Kinase, Receptor-Related 1; Prev. NTRKR1; DJ537F10.1; Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1; Receptor Tyrosine Kinase Like Orphan Receptor 1; ROR1 Protein
-
AA Sequence
QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILY
-
Predicted Molecular Mass
43.3 kDa
-
Molecular Weight
Approximately 58-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
