1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins Enzymes & Regulators
  3. ROR1 Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. ROR family
  5. ROR1 Protein, Mouse (HEK293, His)

ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo.It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling.Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons.ROR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROR1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ROR1 protein shows minimal kinase activity in vitro, indicating an improbable role as a tyrosine kinase in vivo.It functions as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling.Additionally, ROR1 plays a vital role in the inner ear, aiding the innervation of auditory hair cells by spiral ganglion neurons.ROR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived ROR1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It serves as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, ROR1 plays a crucial role in the inner ear, particularly in facilitating the innervation of auditory hair cells by spiral ganglion neurons.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

Q9Z139 (Q30-Y406)

Gene ID
Molecular Construction
N-term
ROR1 (Q30-Y406)
Accession # Q9Z139
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
ROR1; NTRKR1; dJ537F10.1
AA Sequence

QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILY

Predicted Molecular Mass
43.3 kDa
Molecular Weight

Approximately 58-68 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ROR1 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ROR1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P78032
Quantity:
MCE Japan Authorized Agent: