SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc)

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with C-mFc tag^[1][2].

The transmembrane CoV S-protein spike trimer is composed of interwoven protomers that include an N-terminal receptor-binding S1 subunit and a C-terminal S2 subunit that contains the fusion elements. The S1 subunit is subdivided into the N-terminal domain (NTD) followed by the receptor-binding domain (RBD) and two structurally conserved subdomains (SD1 and SD2).

Virus

HEK293

C-mFc

QHD43416.1 (R319-P589)

43740568  [NCBI]

Partial

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP

Approximately 60-80 kDa,based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367(6485): 1444–1448.  [Content Brief]

  [2]. Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087.  [Content Brief]