SELM Protein, Human
Based on 1 Customer Validation
SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.
SELM Protein takes center stage as a potential thiol-disulfide oxidoreductase, playing a pivotal role in the intricate process of disulfide bond formation. This attribution highlights SELM Protein's significance in cellular mechanisms, actively contributing to the nuanced orchestration of molecular interactions. Such functional insights position SELM Protein as a key molecular actor, revealing its involvement in the complex biochemical pathways that govern the establishment of crucial disulfide linkages within the cellular milieu.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8WWX9 (A24-L145, U48S)
-
Molecular Construction
-
N-term
-
SELM (A24-L145, U48S)
Accession # Q8WWX9 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SELENOM; SELM; Selenoprotein M; SelM
-
AA Sequence
ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL
-
Predicted Molecular Mass
13.9 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
