1. Protéines recombinantes
  2. Others
  3. Semenogelin-1 Protein, Human (HEK293, His)

Semenogelin-1 Protein is a major protein in semen and is involved in the formation of a gel matrix that encapsulates accessory glandular secretions and ejaculated sperm. Semenogelin-1 Protein can be hydrolyzed by prostate-specific antigen (PSA) protease to produce a variety of peptide products with different functions. Semenogelin-1 Protein is a predictor of cancer progression and prognosis. Semenogelin-1 Protein, Human (HEK293, His) is the recombinant human-derived Semenogelin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
10 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

Semenogelin-1 Protein is a major protein in semen and is involved in the formation of a gel matrix that encapsulates accessory glandular secretions and ejaculated sperm. Semenogelin-1 Protein can be hydrolyzed by prostate-specific antigen (PSA) protease to produce a variety of peptide products with different functions. Semenogelin-1 Protein is a predictor of cancer progression and prognosis. Semenogelin-1 Protein, Human (HEK293, His) is the recombinant human-derived Semenogelin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Semenogelin-1 is the main protein in semen and is involved in the formation of a gel matrix that encapsulates accessory glandular secretions and ejaculated sperm. Semenogelin-1 can be hydrolyzed by prostate-specific antigen (PSA) protease to produce a variety of peptide products with different functions. One of these peptides, SgI-29, is an antimicrobial peptide with antimicrobial activity. The Semenogelin-1 hydrolysis process also breaks down the gel matrix, allowing the sperm to move more freely. Semenogelin-1 can be used as a predictor of cancer progression and prognosis[1][2][3][4].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH07096.1 (Q24-T402)

Gene ID
Molecular Construction
N-term
Semenogelin-1 (Q24-T402)
Accession # AAH07096.1
6*His
C-term
Protein Length

Partial

Synonyms
Semenogelin-1; Semenogelin I; SGI; SEMG1; SEMG; Alpha-Inhibin-92; Alpha-Inhibin-31; Seminal Basic Protein
AA Sequence

QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFT

Masse moléculaire

29-54 kDa

Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

Semenogelin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Semenogelin-1 Protein, Human (HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Semenogelin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71287
Quantité:
MCE Japan Authorized Agent: