Serpin B9 Protein, Human (HEK293, His)

The Serpin B9 Protein, a member of the serpin family, crucially regulates immune responses by specifically inhibiting granzyme B, a protease involved in immune cell-mediated apoptosis. Acting as a potent inhibitor, Serpin B9 modulates granzyme B's cytotoxic activity, fine-tuning immune responses and preventing unwarranted cell death, emphasizing its significance in maintaining immune balance. Serpin B9 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B9 protein, expressed by HEK293 , with C-6*His labeled tag.

The Serpin B9 Protein functions as a granzyme B inhibitor, playing a crucial role in regulating immune responses. As a member of the serpin family, this protein specifically targets and inhibits granzyme B, a protease involved in immune cell-mediated apoptosis. By acting as a potent inhibitor, Serpin B9 modulates the cytotoxic activity of granzyme B, thereby influencing key processes in immune defense and contributing to the fine-tuning of immune responses. The regulatory capacity of Serpin B9 highlights its significance in maintaining immune balance and preventing unwarranted cell death mediated by granzyme B.

Human

HEK293

C-6*His

P50453 (M1-P376)

5272  [NCBI]

Full Length

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP

35-40 kDa

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.