Serpina1d Protein, Mouse (HEK293, His)

The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with C-His labeled tag.

Serpina1d, a vigilant sentinel in the intricate landscape of cellular regulation, assumes the role of an inhibitor with a specialization in serine proteases. Its watchful gaze extends to trypsin and chymotrypsin, where it demonstrates remarkable efficacy in thwarting their enzymatic activities. However, its prowess takes a nuanced turn, displaying a relative inefficacy against elastase. Serpina1d's strategic inhibition of specific serine proteases underscores its significance as a discerning regulator, contributing to the delicate balance of enzymatic activities within cellular environments.

Mouse

HEK293

C-His

XP_003945711.1 (E25-K413)

20703  [NCBI]

Partial

EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

Approximately 45-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.