Serpina1d Protein, Mouse (HEK293, His)
The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with C-His labeled tag.
Background
Serpina1d, a vigilant sentinel in the intricate landscape of cellular regulation, assumes the role of an inhibitor with a specialization in serine proteases. Its watchful gaze extends to trypsin and chymotrypsin, where it demonstrates remarkable efficacy in thwarting their enzymatic activities. However, its prowess takes a nuanced turn, displaying a relative inefficacy against elastase. Serpina1d's strategic inhibition of specific serine proteases underscores its significance as a discerning regulator, contributing to the delicate balance of enzymatic activities within cellular environments.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
XP_003945711.1 (E25-K413)
-
Molecular Construction
-
N-term
-
Serpina1d (E25-K413)
Accession # XP_003945711.1 -
His
-
C-term
-
-
Protein Length
Full Length of Alpha-1-antitrypsin 1-4 Chain
-
Synonyms
Alpha-1-antitrypsin 1-4; Serine protease inhibitor 1-4; Serpin A1d; Dom4; Spi1-4
-
AA Sequence
EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK
-
Predicted Molecular Mass
44.9 kDa
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
