Serpina1d Protein, Mouse (HEK293, His)

The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Serpina1d protein is a vigilant sentinel in cellular regulation, acting specifically as an inhibitor of serine proteases, particularly trypsin and chymotrypsin. It effectively blocks their enzymatic activity but appears relatively ineffective against elastase. Serpina1d Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpina1d protein, expressed by HEK293 , with C-His labeled tag.

Background

Serpina1d, a vigilant sentinel in the intricate landscape of cellular regulation, assumes the role of an inhibitor with a specialization in serine proteases. Its watchful gaze extends to trypsin and chymotrypsin, where it demonstrates remarkable efficacy in thwarting their enzymatic activities. However, its prowess takes a nuanced turn, displaying a relative inefficacy against elastase. Serpina1d's strategic inhibition of specific serine proteases underscores its significance as a discerning regulator, contributing to the delicate balance of enzymatic activities within cellular environments.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Serpina1d (E25-K413)
      Accession # XP_003945711.1
    • His
    • C-term
  • Protein Length

    Full Length of Alpha-1-antitrypsin 1-4 Chain

  • Synonyms

    Alpha-1-antitrypsin 1-4; Serine protease inhibitor 1-4; Serpin A1d; Dom4; Spi1-4

  • AA Sequence

    EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK

  • Predicted Molecular Mass

    44.9 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00