SGK Protein, Human (sf9, His, GST)
SGK protein is a multifunctional serine/threonine protein kinase that complexly controls multiple cellular processes, including ion channel and transporter regulation, enzymatic activity, transcription factors, neuronal excitability, cell growth, proliferation, survival, and migration. and apoptosis. SGK Protein, Human (sf9, His, GST) is the recombinant human-derived SGK protein, expressed by sf9 insect cells , with N-8*His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SGK protein is a multifunctional serine/threonine protein kinase that complexly controls multiple cellular processes, including ion channel and transporter regulation, enzymatic activity, transcription factors, neuronal excitability, cell growth, proliferation, survival, and migration. and apoptosis. SGK Protein, Human (sf9, His, GST) is the recombinant human-derived SGK protein, expressed by sf9 insect cells , with N-8*His, N-GST labeled tag.
Background
SGK Protein, a versatile serine/threonine-protein kinase, intricately governs an expansive spectrum of cellular processes, ranging from the regulation of ion channels, membrane transporters, and enzymatic activities to the orchestration of transcription factors, neuronal excitability, cell growth, proliferation, survival, migration, and apoptosis. Its pivotal involvement extends to crucial physiological functions, including renal Na(+) retention, renal K(+) elimination, salt appetite, gastric acid secretion, intestinal Na(+)/H(+) exchange, nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization, and memory consolidation. SGK efficiently up-regulates various ion channels and transporters, such as Na(+) channels (SCNN1A/ENAC, SCN5A, and ASIC1/ACCN2), K(+) channels (KCNJ1/ROMK1, KCNA1-5, KCNQ1-5, and KCNE1), and others, influencing diverse cellular processes. It exerts nuanced control over transcription factors, enzymes (GSK3A/B, PMM2, and Na(+)/K(+) ATPase), and pivotal pathways, making it a central player in cellular homeostasis and physiological responses to stress. SGK's regulatory finesse is exemplified in its ability to modulate SCNN1A/ENAC stability by phosphorylating NEDD4L, thereby preventing its degradation and promoting sodium transport. Its intricate involvement in diverse cellular functions underscores its significance in maintaining cellular equilibrium and responding to environmental cues.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His;N-GST
-
Accession
O00141 (S61-L431)
-
Gene ID6446
-
Molecular Construction
-
N-term
-
8*His-GST
-
SGK (S61-L431)
Accession # O00141 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SGK1; Serum/Glucocorticoid Regulated Kinase; Prev. SGK; Serine/Threonine Protein Kinase SGK; Serine/Threonine-Protein Kinase Sgk1; Sgk1 Variant I3; Serum/Glucocorticoid-Regulated Kinase 1; DKFZp686H1615; Serum/Glucocorticoid Regulated Kinase 1; Uncharacte
-
AA Sequence
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)