1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. SGK
  5. SGK1/SGK
  6. SGK Protein, Human (sf9, His, GST)

SGK protein is a multifunctional serine/threonine protein kinase that complexly controls multiple cellular processes, including ion channel and transporter regulation, enzymatic activity, transcription factors, neuronal excitability, cell growth, proliferation, survival, and migration. and apoptosis. SGK Protein, Human (sf9, His, GST) is the recombinant human-derived SGK protein, expressed by sf9 insect cells , with N-8*His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SGK protein is a multifunctional serine/threonine protein kinase that complexly controls multiple cellular processes, including ion channel and transporter regulation, enzymatic activity, transcription factors, neuronal excitability, cell growth, proliferation, survival, and migration. and apoptosis. SGK Protein, Human (sf9, His, GST) is the recombinant human-derived SGK protein, expressed by sf9 insect cells , with N-8*His, N-GST labeled tag.

Background

SGK Protein, a versatile serine/threonine-protein kinase, intricately governs an expansive spectrum of cellular processes, ranging from the regulation of ion channels, membrane transporters, and enzymatic activities to the orchestration of transcription factors, neuronal excitability, cell growth, proliferation, survival, migration, and apoptosis. Its pivotal involvement extends to crucial physiological functions, including renal Na(+) retention, renal K(+) elimination, salt appetite, gastric acid secretion, intestinal Na(+)/H(+) exchange, nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization, and memory consolidation. SGK efficiently up-regulates various ion channels and transporters, such as Na(+) channels (SCNN1A/ENAC, SCN5A, and ASIC1/ACCN2), K(+) channels (KCNJ1/ROMK1, KCNA1-5, KCNQ1-5, and KCNE1), and others, influencing diverse cellular processes. It exerts nuanced control over transcription factors, enzymes (GSK3A/B, PMM2, and Na(+)/K(+) ATPase), and pivotal pathways, making it a central player in cellular homeostasis and physiological responses to stress. SGK's regulatory finesse is exemplified in its ability to modulate SCNN1A/ENAC stability by phosphorylating NEDD4L, thereby preventing its degradation and promoting sodium transport. Its intricate involvement in diverse cellular functions underscores its significance in maintaining cellular equilibrium and responding to environmental cues.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His;N-GST

Accession

O00141 (S61-L431)

Gene ID

6446

Molecular Construction
N-term
8*His-GST
SGK (S61-L431)
Accession # O00141
C-term
Protein Length

Partial

Synonyms
SGK1; Serine/threonine-protein kinase Sgk1; Serum/glucocorticoid-regulated kinase 1
AA Sequence

SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SGK Protein, Human (sf9, His, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SGK Protein, Human (sf9, His, GST)
Cat. No.:
HY-P701784
Quantity:
MCE Japan Authorized Agent: