SGK2 Protein, Human (Active, sf9, GST)
The SGK2 protein is a serine/threonine protein kinase that complexly regulates multiple cellular processes, overseeing ion channels, membrane transporters, and critical aspects of cell growth, survival, and proliferation. Its effects include upregulation of key components such as Na(+) and K(+) channels, amino acid and glutamate transporters, receptors, Na(+)/H(+) exchangers, and Na(+)/K(+) ATPase. SGK2, Human (Active, sf9, GST) is the recombinant human-derived SGK2 protein, expressed by Sf9 insect cells, with labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SGK2 protein is a serine/threonine protein kinase that complexly regulates multiple cellular processes, overseeing ion channels, membrane transporters, and critical aspects of cell growth, survival, and proliferation. Its effects include upregulation of key components such as Na(+) and K(+) channels, amino acid and glutamate transporters, receptors, Na(+)/H(+) exchangers, and Na(+)/K(+) ATPase. SGK2, Human (Active, sf9, GST) is the recombinant human-derived SGK2 protein, expressed by Sf9 insect cells, with labeled tag.
Background
SGK2 Protein, a serine/threonine-protein kinase, intricately orchestrates a diverse array of cellular processes, playing a pivotal role in the regulation of ion channels, membrane transporters, and fundamental aspects of cell growth, survival, and proliferation. Its influence spans a range of key components, including the up-regulation of Na(+) channels (SCNN1A/ENAC), K(+) channels (KCNA3/Kv1.3, KCNE1, and KCNQ1), amino acid transporter (SLC6A19), glutamate transporter (SLC1A6/EAAT4), glutamate receptors (GRIA1/GLUR1 and GRIK2/GLUR6), Na(+)/H(+) exchanger (SLC9A3/NHE3), and the Na(+)/K(+) ATPase. Through its regulatory prowess, SGK2 emerges as a multifaceted kinase with a central role in maintaining the balance and functionality of essential cellular components critical for overall cellular homeostasis and function.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q9HBY8-2 (M1-C367)
-
Gene ID10110
-
Molecular Construction
-
N-term
-
GST
-
SGK2 (M1-C367)
Accession # Q9HBY8-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
SGK2; Non-Specific Serine/Threonine Protein Kinase; Serum/Glucocorticoid Regulated Kinase 2; Serum/Glucocorticoid-Regulated Kinase 2; Serine/Threonine-Protein Kinase Sgk2; DJ138B7.2; SGK2, Serine/Threonine Kinase 2; H-SGK2
-
AA Sequence
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
-
Predicted Molecular Mass
67.9 kDa
-
Molecular Weight
Approximately 67 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
