1. Recombinant Proteins
  2. Others
  3. SHH Protein, Mouse (HEK293, His)

Sonic hedgehog (SHH) undergoes autoproteolysis in the endoplasmic reticulum to produce ShhN and ShhC.ShhN is covalently linked to cholesterol to form ShhNp, a morphogen critical for developmental patterning.SHH Protein, Mouse (HEK293, His) is the recombinant mouse-derived SHH protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE SHH Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Sonic hedgehog (SHH) undergoes autoproteolysis in the endoplasmic reticulum to produce ShhN and ShhC.ShhN is covalently linked to cholesterol to form ShhNp, a morphogen critical for developmental patterning.SHH Protein, Mouse (HEK293, His) is the recombinant mouse-derived SHH protein, expressed by HEK293 , with C-His labeled tag.

Background

The sonic hedgehog protein (SHH) precursor undergoes autoproteolysis and cholesterol transferase activity, resulting in the cleavage of the protein into two parts, ShhN and ShhC. The newly generated ShhN is then covalently attached with a cholesterol moiety at its C-terminal. This process occurs in the endoplasmic reticulum. ShhC is subsequently degraded in the endoplasmic reticulum. The lipidated ShhNp acts as a morphogen and plays a crucial role in various developmental patterning events. It induces ventral cell fate in the neural tube and somites, participates in the anterior-posterior axis patterning of the limb bud, and is essential for axon guidance. SHH binds to the patched (PTCH1) receptor, which, in association with smoothened (SMO), activates the transcription of target genes. In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO.

Biological Activity

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is typically 3.6-40 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q62226 (C25-G198)

Gene ID
Molecular Construction
N-term
SHH (C25-G198)
Accession # Q62226
His
C-term
Protein Length

Partial

Synonyms
Sonic Hedgehog Protein; SHH; HHG-1; ShhNC
AA Sequence

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Predicted Molecular Mass
21 kDa
Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SHH Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SHH Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SHH Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73418
Quantity:
MCE Japan Authorized Agent: