Copy Link Print Information

SHH Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Sonic hedgehog (SHH) undergoes autoproteolysis in the endoplasmic reticulum to produce ShhN and ShhC.ShhN is covalently linked to cholesterol to form ShhNp, a morphogen critical for developmental patterning.SHH Protein, Mouse (HEK293, His) is the recombinant mouse-derived SHH protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SHH Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Sonic hedgehog (SHH) undergoes autoproteolysis in the endoplasmic reticulum to produce ShhN and ShhC.ShhN is covalently linked to cholesterol to form ShhNp, a morphogen critical for developmental patterning.SHH Protein, Mouse (HEK293, His) is the recombinant mouse-derived SHH protein, expressed by HEK293 , with C-His labeled tag.

Background

The sonic hedgehog protein (SHH) precursor undergoes autoproteolysis and cholesterol transferase activity, resulting in the cleavage of the protein into two parts, ShhN and ShhC. The newly generated ShhN is then covalently attached with a cholesterol moiety at its C-terminal. This process occurs in the endoplasmic reticulum. ShhC is subsequently degraded in the endoplasmic reticulum. The lipidated ShhNp acts as a morphogen and plays a crucial role in various developmental patterning events. It induces ventral cell fate in the neural tube and somites, participates in the anterior-posterior axis patterning of the limb bud, and is essential for axon guidance. SHH binds to the patched (PTCH1) receptor, which, in association with smoothened (SMO), activates the transcription of target genes. In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO.

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is typically 3.6-40 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q62226 (C25-G198)

  • Gene ID
    20423  [NCBI]
  • Molecular Construction
    • N-term
    • SHH (C25-G198)
      Accession # Q62226
    • His
    • C-term
  • Protein Length

    Full Length of Sonic hedgehog protein N-product Chain

  • Synonyms

    SHH; Shh Unprocessed N-Terminal Signaling And C-Terminal Autoprocessing Domains; Prev. HLP3; Sonic Hedgehog Protein; Prev. HPE3; ShhNC; MCOPCB5; Sonic Hedgehog (Drosophila) Homolog; SMMCI; Sonic Hedgehog Homolog; TPTPS; Hedgehog Protein; HHG1; HHG-1; TPT;

  • AA Sequence

    CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

  • Predicted Molecular Mass

    21 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SHH Protein, Mouse (HEK293, His) Product Image
    1/16
  • SHH Protein, Mouse (HEK293, His) Product Image