Siglec-15 Protein, Cynomolgus (HEK293, His-Avi)

Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

Siglec-15, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 acts upstream of or within regulation of actin cytoskeleton organization. Siglec-15 deficiency can promote bone formation and reduce bone resorption, indicating that Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis and may serve as a target to inhibit bone resorption and promote bone remodeling that increases bone mass. Siglec-15 is a predominantly macrophage-mediated suppressor of T cell responses. In tumors, Siglec-15 is negatively regulated by IFN-γ, thus influencing effector T cell-mediated antitumor immunity. Genetic ablation or antibody blockade of Siglec-15 amplifies anti-tumor immunity in the TME and inhibits tumor growth in some mouse models. Siglec-15 as a potential target for normalization cancer immunotherapy^[1][2][3][4].

Cynomolgus

HEK293

C-Avi;C-8*His

XP_005586866.2 (M60-T322)

102126346

Extracellular Domain

MESSIRLLACLACVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Approximately 33-43 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Angata T. Siglec-15: a potential regulator of osteoporosis, cancer, and infectious diseases. J Biomed Sci. 2020 Jan 3;27(1):10.  [Content Brief]

  [2]. Wang J, et al. Siglec-15 as an immune suppressor and potential target for normalization cancer immunotherapy. Nat Med. 2019 Apr;25(4):656-666.  [Content Brief]

  [3]. Kang FB, et al. The diverse functions of Siglec-15 in bone remodeling and antitumor responses. Pharmacol Res. 2020 May;155:104728.  [Content Brief]

  [4]. Rashid S, et al. Molecular structure, expression, and the emerging role of Siglec-15 in skeletal biology and cancer. J Cell Physiol. 2022 Mar;237(3):1711-1719.