Siglec-15 Protein, Cynomolgus (HEK293, His-Avi)
Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Siglec-15 Protein, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis, inhibiting antigen-specific T cell responses in vitro and in vivo. Siglec-15 Protein, Cynomolgus (HEK293, His-Avi) is the recombinant cynomolgus-derived Siglec-15 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
Background
Siglec-15, a Siglec family member and type-1 transmembrane protein, is constitutively expressed in osteoclasts, macrophages and dendritic cells. Siglec-15 acts upstream of or within regulation of actin cytoskeleton organization. Siglec-15 deficiency can promote bone formation and reduce bone resorption, indicating that Siglec-15 plays a pivotal role in the development and differentiation of osteoclastogenesis and may serve as a target to inhibit bone resorption and promote bone remodeling that increases bone mass. Siglec-15 is a predominantly macrophage-mediated suppressor of T cell responses. In tumors, Siglec-15 is negatively regulated by IFN-γ, thus influencing effector T cell-mediated antitumor immunity. Genetic ablation or antibody blockade of Siglec-15 amplifies anti-tumor immunity in the TME and inhibits tumor growth in some mouse models. Siglec-15 as a potential target for normalization cancer immunotherapy[1][2][3][4].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
XP_005586866.2 (M60-T322)
-
Gene ID102126346
-
Molecular Construction
-
N-term
-
Siglec-15 (M60-T322)
Accession # XP_005586866.2 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SIGLEC15; Sialic Acid-Binding Ig-Like Lectin 15; Prev. CD33L3; SIGLEC-15; CD33 Antigen-Like 3; Sialic Acid Binding Ig-Like Lectin 15; HsT1361; Siglec-15; Sialic Acid Binding Ig Like Lectin 15; CD33 Molecule-Like 3
-
AA Sequence
MESSIRLLACLACVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
-
Predicted Molecular Mass
29.2 kDa
-
Molecular Weight
Approximately 33-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 20mM PB, 0.5M NaCl, 5% glycerol, 0.1M L-Arginine, pH 6.0.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Angata T. Siglec-15: a potential regulator of osteoporosis, cancer, and infectious diseases. J Biomed Sci. 2020 Jan 3;27(1):10. [Content Brief]
[2]. Wang J, et al. Siglec-15 as an immune suppressor and potential target for normalization cancer immunotherapy. Nat Med. 2019 Apr;25(4):656-666. [Content Brief]
[3]. Kang FB, et al. The diverse functions of Siglec-15 in bone remodeling and antitumor responses. Pharmacol Res. 2020 May;155:104728. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
