Copy Link Print Information

Siglec-6 Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Siglec-6 Protein, Human (HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The Siglec-6 Protein is a putative adhesion molecule that functions by mediating sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Notably, the sialic acid recognition site of Siglec-6 may be masked by cis interactions with sialic acids on the same cell surface, suggesting a dynamic regulation of its binding properties. In addition to its adhesion role, Siglec-6 interacts with LEP, implying its involvement in cellular interactions and signaling processes. The multifaceted nature of Siglec-6 underscores its potential as a key player in sialic acid-mediated cellular adhesion and communication pathways.

Verified Bioactivity

Immobilized Human Siglec-6, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-Siglec-6 Antibody, hFc Tag with the EC50 of 3-3.5 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    O43699-3 (Q27-V331)

  • Gene ID
    946  [NCBI]
  • Molecular Construction
    • N-term
    • Siglec-6 (E27-V331)
      Accession # O43699-3
    • 8*His-Avi
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    SIGLEC6; SIGLEC-6; Prev. CD33L1; Sialic Acid Binding Ig-Like Lectin 6; Prev. CD33L; CD327 Antigen; OB-BP1; Siglec-6; CD327; CD33L2; Sialic Acid-Binding Ig-Like Lectin 6; CDW327; Obesity-Binding Protein 1; CDw327; CD33 Antigen-Like 1; Sialic Acid Binding I

  • AA Sequence

    QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV

  • Molecular Weight

    Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Siglec-6 Protein, Human (HEK293, His-Avi) Product Image
    1/16
  • Siglec-6 Protein, Human (HEK293, His-Avi) Product Image