1. Recombinant Proteins
  2. Receptor Proteins
  3. Siglec
  4. Siglec-6 Protein, Human (HEK293, His-Avi)

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The Siglec-6 Protein is a putative adhesion molecule that functions by mediating sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Notably, the sialic acid recognition site of Siglec-6 may be masked by cis interactions with sialic acids on the same cell surface, suggesting a dynamic regulation of its binding properties. In addition to its adhesion role, Siglec-6 interacts with LEP, implying its involvement in cellular interactions and signaling processes. The multifaceted nature of Siglec-6 underscores its potential as a key player in sialic acid-mediated cellular adhesion and communication pathways.

Biological Activity

Immobilized Human Siglec-6, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-Siglec-6 Antibody, hFc Tag with the EC50 of 3-3.5 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

O43699-3 (Q27-V331)

Gene ID

946  [NCBI]

Molecular Construction
N-term
Siglec-6 (E27-V331)
Accession # O43699-3
8*His-Avi
C-term
Protein Length

Partial

Synonyms
CD327; CD33 antigen-like 1; CD33L1; CDw327; OB-BP1; Siglec-6; SIGLEC6; CD33L; OBBP1
AA Sequence

QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV

분자량

Approximately 55-70 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Siglec-6 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Siglec-6 Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Siglec-6 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P700825
수량:
MCE Japan Authorized Agent: