SLAMF2/CD48 Protein, Rat (HEK293, hFc)
SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, hFc) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, hFc) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SLAMF2, also known as CD48, is a glycosylphosphatidylinositol (GPI)-anchored cell surface glycoprotein that plays a crucial role in immune cell regulation. Through its N-terminal immunoglobulin domain, SLAMF2 interacts with cell surface receptors, such as 2B4/CD244 or CD2, to modulate immune cell function and activation. In T-cell signaling transduction, SLAMF2 forms complexes with CD2, facilitating the recruitment of the Src family protein kinase LCK and LAT to the TCR/CD3 complex. This interaction leads to the phosphorylation and subsequent activation of LCK. Additionally, SLAMF2 induces the phosphorylation of the cytoplasmic immunoreceptor tyrosine switch motifs (ITSMs) of CD244, initiating signaling events that culminate in the formation of the immunological synapse and the targeted release of cytolytic granules containing perforin and granzymes by T-lymphocytes and NK-cells. SLAMF2 establishes direct interactions with CD2, CD244, and LCK, contributing to its regulatory role in immune responses.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
P10252 (F23-R216)
-
Molecular Construction
-
N-term
-
CD48 (F23-R216)
Accession # P10252 -
hFc
-
C-term
-
-
Protein Length
Full Length of CD48 antigen Chain
-
Synonyms
CD48; MCD48; Prev. BCM1; CD48 Antigen (B-Cell Membrane Protein); SLAMF2; B-Lymphocyte Activation Marker BLAST-1; Signaling Lymphocytic Activation Molecule 2; Leukocyte Antigen MEM-102; BCM1 Surface Antigen; BLAST1; SLAM Family Member 2; TCT.1; CD48 Antige
-
AA Sequence
FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR
-
Predicted Molecular Mass
49.5 kDa
-
Molecular Weight
Approximately 38-44 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)