SLAMF6 Protein, Human (HEK293, His-Avi)

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

SLAMF6, a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, plays a crucial role in modulating the activation and differentiation of diverse immune cells, contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of SLAMF6 are finely controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and/or SH2D1B/EAT-2. Notably, SLAMF6 triggers cytolytic activity specifically in natural killer (NK) cells expressing high surface densities of natural cytotoxicity receptors and engages positive signaling in NK cells, involving the phosphorylation of VAV1 and dependence on SH2D1B rather than SH2D1A. In conjunction with SLAMF1, SLAMF6 governs the transition and differentiation of the thymocytic natural killer T (NKT) cell lineage. Additionally, SLAMF6 promotes T-cell differentiation into a Th17 phenotype, leading to increased IL-17 secretion, and acts in concert with SLAMF1 and CD84/SLAMF5 as a potential negative regulator of the humoral immune response. Furthermore, in the absence of SH2D1A/SAP, SLAMF6 can transmit negative signals to CD4(+) T-cells and NKT cells, negatively regulating germinal center formation and potentially contributing to B-cell tolerance in germinal centers while preventing autoimmunity. SLAMF6 exists as a homodimer and interacts with PTN6 and PTN11, as well as with SH2D1A/SAP and SH2D1B/EAT2, with both adapter proteins able to associate with the same SLAMF6 molecule, mediated by ITSM 2.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SLAMF6 (Q22-K225)
      Accession # Q96DU3-1
    • 6*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SLAMF6; CD352; SLAM Family Member 6; NTBA; NTB-A; Activating NK Receptor; KALI; NK-T-B-Antigen; SF2000; Natural Killer-, T- And B-Cell Antigen; KALIb; NTBA Receptor; Ly108; CD352 Antigen

  • AA Sequence

    QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

  • Predicted Molecular Mass

    25.8 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00