SLAMF6 Protein, Human (HEK293, His-Avi)
SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
SLAMF6, a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, plays a crucial role in modulating the activation and differentiation of diverse immune cells, contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of SLAMF6 are finely controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and/or SH2D1B/EAT-2. Notably, SLAMF6 triggers cytolytic activity specifically in natural killer (NK) cells expressing high surface densities of natural cytotoxicity receptors and engages positive signaling in NK cells, involving the phosphorylation of VAV1 and dependence on SH2D1B rather than SH2D1A. In conjunction with SLAMF1, SLAMF6 governs the transition and differentiation of the thymocytic natural killer T (NKT) cell lineage. Additionally, SLAMF6 promotes T-cell differentiation into a Th17 phenotype, leading to increased IL-17 secretion, and acts in concert with SLAMF1 and CD84/SLAMF5 as a potential negative regulator of the humoral immune response. Furthermore, in the absence of SH2D1A/SAP, SLAMF6 can transmit negative signals to CD4(+) T-cells and NKT cells, negatively regulating germinal center formation and potentially contributing to B-cell tolerance in germinal centers while preventing autoimmunity. SLAMF6 exists as a homodimer and interacts with PTN6 and PTN11, as well as with SH2D1A/SAP and SH2D1B/EAT2, with both adapter proteins able to associate with the same SLAMF6 molecule, mediated by ITSM 2.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q96DU3-1 (Q22-K225)
-
Molecular Construction
-
N-term
-
SLAMF6 (Q22-K225)
Accession # Q96DU3-1 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLAMF6; CD352; SLAM Family Member 6; NTBA; NTB-A; Activating NK Receptor; KALI; NK-T-B-Antigen; SF2000; Natural Killer-, T- And B-Cell Antigen; KALIb; NTBA Receptor; Ly108; CD352 Antigen
-
AA Sequence
QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK
-
Predicted Molecular Mass
25.8 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)