1. Recombinant Proteins
  2. Others
  3. SLC27A4/FATP4 Protein, Human (HEK293, His)

The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.

Background

SLC27A4/FATP4 Protein assumes a central role in cellular processes by mediating the levels of long-chain fatty acids (LCFA) within the cell, facilitating their transport across cell membranes. Widely implicated in fatty acid regulation, this protein appears to be the principal fatty acid transporter in small intestinal enterocytes, playing a crucial role in fat absorption during early embryogenesis. Additionally, SLC27A4/FATP4 functions as an acyl-CoA ligase, catalyzing the ATP-dependent formation of fatty acyl-CoA from LCFA and very-long-chain fatty acids (VLCFA) substrates. This catalytic activity not only prevents fatty acid efflux from cells but also potentially enhances fatty acid uptake. The protein is further involved in the formation of the epidermal barrier and likely participates in fatty acid transport across the blood barrier. Indirectly inhibiting RPE65 via substrate competition and the production of VLCFA derivatives such as lignoceroyl-CoA, SLC27A4/FATP4 contributes to the prevention of light-induced degeneration of rods and cones, highlighting its diverse and vital roles in cellular and physiological processes.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q6P1M0-1 (Q483-L643)

Gene ID
Molecular Construction
N-term
His
SLC27A4 (Q483-L643)
Accession # Q6P1M0
C-term
Protein Length

Partial

Synonyms
Long-chain fatty acid transport protein 4; Arachidonate--CoA ligase; ACSVL4
AA Sequence

QAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

Molecular Weight

Approximately 20-25 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SLC27A4/FATP4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SLC27A4/FATP4 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLC27A4/FATP4 Protein, Human (HEK293, His)
Cat. No.:
HY-P77206
Quantity:
MCE Japan Authorized Agent: