SLC27A4/FATP4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.
Background
SLC27A4/FATP4 Protein assumes a central role in cellular processes by mediating the levels of long-chain fatty acids (LCFA) within the cell, facilitating their transport across cell membranes. Widely implicated in fatty acid regulation, this protein appears to be the principal fatty acid transporter in small intestinal enterocytes, playing a crucial role in fat absorption during early embryogenesis. Additionally, SLC27A4/FATP4 functions as an acyl-CoA ligase, catalyzing the ATP-dependent formation of fatty acyl-CoA from LCFA and very-long-chain fatty acids (VLCFA) substrates. This catalytic activity not only prevents fatty acid efflux from cells but also potentially enhances fatty acid uptake. The protein is further involved in the formation of the epidermal barrier and likely participates in fatty acid transport across the blood barrier. Indirectly inhibiting RPE65 via substrate competition and the production of VLCFA derivatives such as lignoceroyl-CoA, SLC27A4/FATP4 contributes to the prevention of light-induced degeneration of rods and cones, highlighting its diverse and vital roles in cellular and physiological processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q6P1M0-1 (Q483-L643)
-
Molecular Construction
-
N-term
-
His
-
SLC27A4 (Q483-L643)
Accession # Q6P1M0 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SLC27A4; Acyl-CoA Synthetase Very Long Chain Family Member 4; Solute Carrier Family 27 Member 4; Very Long-Chain Acyl-CoA Synthetase 4; ACSVL4; Long-Chain-Fatty-Acid--CoA Ligase; FATP4; Fatty Acid Transport Protein 4; Long-Chain Fatty Acid Transport Prote
-
AA Sequence
QAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
