Sorcin/SRI Protein, Human (E.coli, GST)
The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (E.coli, GST) is the recombinant human-derived Sorcin/SRI protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (E.coli, GST) is the recombinant human-derived Sorcin/SRI protein, expressed by E. coli , with N-GST labeled tag.
Background
Sorcin (SRI) is a calcium-binding protein crucial for regulating excitation-contraction coupling in the heart, playing a significant role in maintaining calcium homeostasis within the sarcoplasmic reticulum. SRI has been identified as a modulator of RYR2 calcium channels, suggesting its involvement in finely tuning intracellular calcium dynamics. Existing as a homodimer, SRI also engages in protein-protein interactions, forming complexes with GCA, RYR2, and ANXA7.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P30626 (M1-V198)
-
Molecular Construction
-
N-term
-
GST
-
SRI (M1-V198)
Accession # P30626 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SRI; CP22; Sorcin; V19; Calcium Binding Protein Amplified In Mutlidrug-Resistant Cells; H_RG167B05.1; 22 KDa Protein; SCN; CP-22
-
AA Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
-
Predicted Molecular Mass
48.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/ug, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
